(data stored in ACNUC7421 zone)

EMBL: AP011115.PRCA

AP011115.PRCA        Location/Qualifiers
FT   CDS_pept        complement(599747..600526)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prcA"
FT                   /locus_tag="ROP_05810"
FT                   /product="20S proteasome alpha-type subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05810"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48828"
FT                   /db_xref="GOA:C1ASP6"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022296"
FT                   /db_xref="InterPro:IPR023332"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASP6"
FT                   /protein_id="BAH48828.1"
FT                   /translation="MTMPYYASAEQIMRDRSELARKGIARGRSVVVLTFRDGVLFVAEN
FT                   PSTALHKVSELYDRLGFAAVGKYNEFENLRRAGIVHADMRGYSYDRRDVTGRSLANAYA
FT                   QTLGTIFTEQPKPYEVEICVAEVGRVGSPKAPQLYRITYDGSIVDEQHFVVMGGTTEPI
FT                   ATAMRESYRADLDLEAAVGIAVNALRQGGAGEGEKRNVDVASLEVAVLDQSRPRRAFRR
FT                   IAGAALEQLVPAAPAAASESAPEPKPDTETKPADPQD"
     atgaccatgc cgtattacgc ctccgccgag cagatcatgc gggaccgctc ggaactggcg        60
     cgcaagggaa ttgcccgggg acgcagcgtc gtggttctca cgttccgcga cggcgtgctg       120
     ttcgtcgcgg agaatccgtc caccgccctg cacaaggtca gtgaactgta cgaccggctc       180
     ggcttcgccg ccgtcggcaa gtacaacgag ttcgagaacc tgcggcgcgc cgggatcgtc       240
     cacgccgaca tgcgcggcta ctcctacgac cgccgtgacg tgacgggccg atcgctggcc       300
     aacgcgtacg cgcagaccct gggcacgatc ttcaccgaac agcccaagcc gtacgaggtg       360
     gagatctgcg tcgcggaggt cggacgggtg ggcagcccga aggcgcccca gctgtaccgc       420
     atcacgtacg acggatccat cgtcgacgaa cagcatttcg tggtgatggg tggcacgacg       480
     gagccgatcg cgaccgccat gcgcgagtcg taccgtgccg acctcgatct cgaggctgcg       540
     gtcggcatcg cggtcaacgc tctgcgccag ggcggtgcgg gggagggcga gaagcggaac       600
     gtcgacgtgg ccagcctcga ggtggccgtg ctcgatcagt cccgtcctcg ccgcgcattc       660
     cggcggatcg ccggagccgc gctcgaacag ctggttcccg cagcgccggc ggccgcctcg       720
     gaatccgctc cggagccgaa gccggacacc gagacgaagc cggccgaccc tcaggactga       780
//

If you have problems or comments...

PBIL Back to PBIL home page