(data stored in ACNUC7421 zone)

EMBL: AP011115.PRCB

AP011115.PRCB        Location/Qualifiers
FT   CDS_pept        complement(600523..601407)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prcB"
FT                   /locus_tag="ROP_05820"
FT                   /product="20S proteasome beta-type subunit"
FT                   /EC_number="3.4.25.1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05820"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48829"
FT                   /db_xref="GOA:C1ASP7"
FT                   /db_xref="InterPro:IPR001353"
FT                   /db_xref="InterPro:IPR022483"
FT                   /db_xref="InterPro:IPR023333"
FT                   /db_xref="InterPro:IPR029055"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASP7"
FT                   /protein_id="BAH48829.1"
FT                   /translation="MTADRPALRTGDGDTRLSFGSNLSSFTEYLRGHAPELLPENRIGH
FT                   RSHSTRGGDGMESGDLAPHGTTIVALTYKGGVLLAGDRRATQGNLIASRDVEKVYVTDE
FT                   YSAAGIAGTAGIAIELVRLFAVELEHYEKIEGVPLTFDGKANRLASMVRGNLGAAMQGL
FT                   AVVPLLVGYDLDADEEARAGRIVSYDVVGGRYEERAGYHAVGSGSLFAKSALKKIYSPD
FT                   SDEETALRAAIESLYDAADDDSATGGPDLTRGIYPTAVTITQAGAVHVSEETTSELARR
FT                   IVAERTEEGGSAR"
     gtgacggcgg atcgaccggc attgcggaca ggcgacggtg acacgaggct cagtttcggt        60
     tcgaatctga gctcgttcac cgaatatctg cgtggtcacg caccagaatt gctgccggag       120
     aatcggatcg gccatcgttc gcactcgaca cggggtggtg acgggatgga gagcggtgat       180
     ctcgcaccgc acggaacgac gatcgtggcg ctcacctaca agggcggcgt cctgctcgca       240
     ggcgaccggc gcgcgaccca gggcaacctg atcgccagcc gggacgtcga gaaggtgtac       300
     gtcaccgacg agtactcggc ggccggtatc gccggcaccg cgggcatcgc catcgaactg       360
     gtgcgcctgt tcgccgtcga actcgagcac tacgagaaga tcgagggcgt tccgctgacg       420
     ttcgacggta aggccaaccg cctggcgtcg atggtgcggg gcaacctcgg ggcggcgatg       480
     cagggtctcg cggtcgtccc gctgctggtc ggctacgacc tcgacgcgga cgaagaggcc       540
     cgggcgggcc gcatcgtctc gtacgacgtc gtcggcggcc gctacgagga acgcgccgga       600
     taccacgcgg tcggttcggg gtcgctgttc gcgaagtcgg cgctgaagaa gatctactcg       660
     ccggacagcg acgaggagac tgccctgcgg gcggccatcg aatcgctgta cgacgcggcc       720
     gacgacgact cggccaccgg tgggcccgac ctgacccgcg gcatctaccc gaccgcggtc       780
     acgatcaccc aggccggtgc cgtccacgtg tccgaggaga cgacgtccga gttggctcgg       840
     cgcatcgtcg ccgagcgcac cgaagaaggg gggtctgcgc gatga                       885
//

If you have problems or comments...

PBIL Back to PBIL home page