(data stored in ACNUC7421 zone)

EMBL: AP011115.PRPA

AP011115.PRPA        Location/Qualifiers
FT   CDS_pept        501155..503692
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="prpA"
FT                   /locus_tag="ROP_04920"
FT                   /product="serine/threonine protein phosphatase PrpA"
FT                   /EC_number="3.1.3.16"
FT                   /note="protein synonym:phosphoprotein phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48739"
FT                   /db_xref="GOA:C1ARR2"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR024028"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR032380"
FT                   /db_xref="InterPro:IPR032390"
FT                   /db_xref="InterPro:IPR041780"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR2"
FT                   /protein_id="BAH48739.1"
FT                   /translation="MTDISVPALSLVVLVGVSGSGKSSFAAQHFAPTQVLSSDFCRGLV
FT                   ADDENDQSATSDAFDVLLYIAGTRLRRGLLTVVDATNVQREARKALVDLAKSHDVLVDA
FT                   IVIDVPDDVAIARNATRPDRDFGPHVIRRQHKDLRRSLPKLGREGFRRVHVLTGVEAID
FT                   SATVSIEKAWTDKRDLTGPFDIIGDVHGCRSELETLLRELGWQLQPDGAGAHHPEGRTA
FT                   VFVGDLVDRGPDTPGVLRLVMGMVAAGTALCVSGNHEQKLSRALHGRNVTTSHGLQASL
FT                   DQLAAESDDFRKSAHAFIDGLISHYELDGGNLVVAHAGLKEAYHGRASARVRSFALYGD
FT                   TTGETDEYGLPVRYPWAHDYRGRAFVVYGHTPVPETEWINNTICLDTGVVFGGRLTALR
FT                   YPGKDIVSVPAEQVWFEPARPLDTASARPGHRTQRDPTLLSIDDVRGTRHIDVRYNKGR
FT                   IKVREENAAAALEIMSRFAVDPRWLVYLPPTMAPPATSNLDGYLEHPVQAFAEFAAAGV
FT                   GEVVCEEKHMGSRAIAVVARDAATAAERFGVTDGSSGIVYTRTGRPFFDDPATMSELVA
FT                   RLRTACTPLMDDLGSSWLALDCELLPWSAKAGELIRTQYASVGAAAGAALPDAITALER
FT                   AAARGLDVADLLTHNRTREANARLFREAYARYCWPVTGLDGVRLAPFQILACEGRATAV
FT                   TEPHSWHLAKLATLDDPLVAGTRHQFVDLTSDESRHAATTWWSQLTDAGGEGMVVKPLG
FT                   PTPAELAHRRIQPGIKVRGREYLRIIYGPDYTENLDVLRDRSLGRKRSMALREHALGLE
FT                   ALTRLTEGDPLWRVHETVFAVLALESEPVDPRL"
     atgactgaca tctcggtgcc ggcactgtcg ctggtggttc tcgtgggtgt gtccggcagt        60
     ggcaaatcca gcttcgccgc acagcatttc gcaccgaccc aggtgctgtc ctccgacttc       120
     tgccggggac tggtcgccga cgacgaaaac gaccagtccg caacctcgga cgctttcgac       180
     gtgctgctct acatcgccgg aacccgactg cgacgtggcc tgctcacggt cgtcgatgcc       240
     accaatgtgc agcgcgaagc gcgcaaggca ttggtcgatc tggccaaatc ccacgacgtt       300
     ctggtggacg cgatcgtgat cgacgttccc gacgacgtcg cgatcgcgcg caacgcgacc       360
     cgaccggacc gcgacttcgg tccacacgtg atccgacggc agcacaagga ccttcggcgg       420
     tcgctgccga agctcggccg cgaaggattc cggcgagtgc atgtgctcac cggagtcgag       480
     gccatcgact cggcgaccgt gtcgatcgag aaggcctgga ccgacaagcg agatctgacc       540
     ggacctttcg acatcatcgg cgacgtccac ggctgccgaa gcgaactgga aacgctgctg       600
     cgcgaactcg gctggcaact ccagcccgac ggcgcaggcg cccaccaccc cgaggggcgg       660
     accgcggtgt tcgtcggcga cctggtcgac cgcggaccgg acaccccggg agtgctgcgc       720
     ctggtgatgg gcatggttgc ggccgggact gccctgtgtg tctcgggcaa tcacgaacag       780
     aagctctccc gcgcgctgca cggccggaac gtcaccacct cgcacgggct gcaggcgtcg       840
     ctggatcagc tcgcagcgga atccgacgac ttccgcaagt ccgcgcatgc attcatcgac       900
     ggcctgatca gccactacga actcgacggc ggcaatctgg tggtcgcgca cgccgggctg       960
     aaggaggcct accacggccg cgcatcggcg cgggtgcgct cgttcgccct ctacggcgac      1020
     accaccggtg agaccgacga gtacggactg ccggtgcgct acccgtgggc ccacgactac      1080
     cgtggacggg cgttcgtcgt gtacggccac acccccgtgc cggagaccga gtggatcaac      1140
     aacaccatct gcctcgacac cggtgtcgtc ttcggtggca ggctgaccgc cctgcgctac      1200
     cccggtaagg acatcgtgtc cgttccggcc gagcaggtgt ggttcgaacc ggcgcgacca      1260
     ctcgacacgg catcggccag gccgggccat cggacgcagc gcgatccgac cctgttgtcc      1320
     atcgacgacg tgcgcggaac acggcacatc gacgtccggt acaacaaggg acgcatcaag      1380
     gtgcgcgagg agaacgccgc cgctgcgctc gagatcatga gccgattcgc cgtcgaccca      1440
     cgctggctgg tgtacctgcc gccgaccatg gccccaccgg ccacctcgaa cctcgacgga      1500
     tacctggaac accctgtgca ggccttcgcc gagttcgcgg cggctggggt cggcgaggtc      1560
     gtgtgcgagg agaagcacat gggttcccgg gccatcgccg tggtggcccg tgatgccgca      1620
     accgcggcgg agcggttcgg cgtcaccgac ggaagctcgg gaatcgtcta cacccgcacc      1680
     ggccgaccgt tcttcgacga cccggccacg atgagcgaac tggtggcccg gctccgcacc      1740
     gcgtgcactc cgctgatgga cgacctcggg tcgtcgtggc tggcgctcga ttgcgaactg      1800
     ctgccgtggt cggcgaaggc aggagagctg atccgcaccc agtacgcatc ggtcggcgcc      1860
     gcggcgggtg cggcgctgcc ggacgcgatc accgcactgg aacgggccgc agcgagggga      1920
     ttggatgtcg cagacctgtt gactcacaac cgaacccgcg aggccaacgc tcgtcttttc      1980
     agggaggcgt acgcgcggta ctgctggccg gtgaccggtc tggacggggt gcggctcgcg      2040
     ccgttccaga tcctcgcctg tgaaggccgc gcgaccgccg tcaccgaacc gcactcctgg      2100
     cacctggcga agctggcgac actcgacgat ccgctcgtcg ccgggaccag gcatcagttc      2160
     gtcgatctca cgtccgacga gtcccggcac gcggcgacca cctggtggtc gcaactgacc      2220
     gacgccggcg gtgagggcat ggtggtcaag ccactcggcc ccacacccgc agaactggca      2280
     catcgacgga tccagccggg catcaaggtg cgggggcggg aatatctgcg catcatctac      2340
     ggccccgact acaccgagaa cctcgacgtc ctccgcgacc gctccctcgg tcgcaaacga      2400
     tcgatggccc tgcgcgaaca tgcgctcggc ctcgaggcgc tgacccggct caccgaaggc      2460
     gacccgctgt ggcgagtgca cgaaacggtg ttcgcggttc tggcgctcga gtccgagccg      2520
     gtggacccac ggctgtag                                                    2538
//

If you have problems or comments...

PBIL Back to PBIL home page