(data stored in ACNUC7421 zone)

EMBL: AP011115.PYK

AP011115.PYK         Location/Qualifiers
FT   CDS_pept        complement(766677..768095)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyk"
FT                   /locus_tag="ROP_07330"
FT                   /product="pyruvate kinase"
FT                   /EC_number="2.7.1.40"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07330"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48980"
FT                   /db_xref="GOA:C1AT48"
FT                   /db_xref="InterPro:IPR001697"
FT                   /db_xref="InterPro:IPR011037"
FT                   /db_xref="InterPro:IPR015793"
FT                   /db_xref="InterPro:IPR015795"
FT                   /db_xref="InterPro:IPR015806"
FT                   /db_xref="InterPro:IPR015813"
FT                   /db_xref="InterPro:IPR018209"
FT                   /db_xref="InterPro:IPR036918"
FT                   /db_xref="InterPro:IPR040442"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT48"
FT                   /protein_id="BAH48980.1"
FT                   /translation="MNRRTKIVCTLGPATATGDRIRELVESGMDVARLNFSHGEHADHE
FT                   ENYKRVRAASDATGKAVGVLADLQGPKIRLGRFAEGRTTWANGEEVRITVEECEGTHDR
FT                   VSTTYKQLAEDAKPGDRLLVDDGKVGLVVSGVEGNDVICRVTEGGPVSNNKGVSLPGMN
FT                   VSVPALSEKDIADLEFALGLGVDFIALSFVRSPADVELVHAVMDRVGRRIPVIAKLEKP
FT                   EAIDNLEAIVLAFDAVMVARGDLGVELPLEQVPLVQKRAIQIARENAKPVIVATQMLES
FT                   MIENSRPTRAEASDVANAVLDGADAVMLSGETSVGKYVMETVRTMARIVEAVENESTQV
FT                   PPLTHVPRTKRGVISYAARDIGERLDAKALVAFTQSGDTVRRLARLHTPLPLLAFTPLP
FT                   EVRSQLSLTWGTETFIVDPVDSTDAMVRQVDNALLGLGRYQKGELVVIVAGSPPGTVGS
FT                   TNLIHVHRIGEEDH"
     gtgaaccgac gcacgaagat cgtatgcaca cttggacctg ctaccgccac cggtgaccgt        60
     attcgcgagc tcgtcgagag cggtatggat gtggcgcggc tgaatttcag ccacggcgag       120
     cacgccgatc acgaggagaa ctacaaacgt gtgagggcgg cctcggacgc gacgggtaag       180
     gcggtcggtg tcctggccga cctgcagggg ccgaagatcc ggttgggccg gttcgcggag       240
     gggcgcacca cgtgggcgaa cggtgaggag gtgcggatca ccgtcgagga gtgtgagggc       300
     acccacgacc gggtctcgac cacgtacaag cagctggccg aggacgccaa gccgggggac       360
     cggttgctgg tggacgacgg caaggtcggt ctggtggtct ccggggtgga gggcaatgac       420
     gtgatctgcc gggtcaccga gggcggcccg gtgtcgaaca acaagggtgt gtcgctgccg       480
     gggatgaatg tgtcggttcc ggcgctgtcg gagaaggaca tcgcggatct ggagttcgcg       540
     ctcgggttgg gtgtcgattt catcgcgttg tcgttcgtgc ggtcgccggc ggatgtggag       600
     ttggtgcatg cggtgatgga ccgggtgggt cggcggattc cggtgatcgc gaagttggag       660
     aagccggagg cgatcgacaa tctcgaggcg atcgtgctgg cgttcgatgc ggtgatggtg       720
     gcgcggggtg atctgggtgt ggagttgccg ctcgagcagg tgccgttggt gcagaagcgg       780
     gcgattcaga ttgcgcggga gaacgcgaag ccggtgatcg tggcgacgca gatgctggag       840
     tcgatgatcg agaactcgcg gccgacccgg gcggaggcct cggatgtggc gaacgcggtc       900
     ctcgacgggg cggatgcggt gatgctgtcc ggggagacgt cggtgggtaa gtacgtgatg       960
     gagacggtgc gcacgatggc gcggatcgtg gaggcggtgg agaacgagtc cacgcaggtg      1020
     ccgccgctga cgcatgtgcc gcggaccaag cggggggtga tctcgtacgc ggcccgcgac      1080
     atcggggagc gcctggatgc gaaggcgttg gtggcgttca cgcagtcggg ggacacggtg      1140
     cgccggttgg cgcggttgca tacgccgttg ccgttgctgg cgttcacgcc gttgccggag      1200
     gtgcgcagcc agttgtcgtt gacgtggggg acggagacgt tcatcgtcga cccggtcgac      1260
     agcacggatg cgatggtgcg gcaggtcgac aacgcgctgc tcgggttggg ccggtaccag      1320
     aagggtgaac tcgtggtgat cgtggcgggg tcgccgccgg gcaccgtagg ctcgaccaac      1380
     ctgatccacg tccacagaat cggcgaagag gaccactag                             1419
//

If you have problems or comments...

PBIL Back to PBIL home page