(data stored in ACNUC7421 zone)

EMBL: AP011115.PYRG

AP011115.PYRG        Location/Qualifiers
FT   CDS_pept        complement(686308..688077)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="pyrG"
FT                   /locus_tag="ROP_06640"
FT                   /product="CTP synthase"
FT                   /EC_number="6.3.4.2"
FT                   /note="protein synonym:UTP--ammonia ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06640"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48911"
FT                   /db_xref="GOA:C1ASX9"
FT                   /db_xref="InterPro:IPR004468"
FT                   /db_xref="InterPro:IPR017456"
FT                   /db_xref="InterPro:IPR017926"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR033828"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ASX9"
FT                   /protein_id="BAH48911.1"
FT                   /translation="MPQSRTHSRTATKHIFVSGGVASSLGKGLTASSLGQLLTARGMRV
FT                   TMQKLDPYLNVDPGTMNPFQHGEVFVTEDGAETDLDVGHYERFLDRDLSGQANVTTGQV
FT                   YSTVIAKERRGEYLGDTVQVIPHITDEIKSRILAMSGPDLQGHRPDVVITEIGGTVGDI
FT                   ESQPFLEAARQVRHDVGRDNVFFLHVSLVPYLAPSGELKTKPTQHSVAALRNIGIQPDA
FT                   LILRCDREVPPALKNKIALMCDVDVDGCISTPDAPSIYDIPKVLHSEGLDAYVVRQLGL
FT                   PFRDVDWTVWGNLLERVHQPRETVRIALVGKYVDLPDAYLSVTEALRAGGFANRSKVEI
FT                   SWVPSDACETEAGAQAALGDVDGVLIPGGFGIRGIEGKLGAIRYARHRKTPLLGLCLGL
FT                   QCVVIEAARSVGLDDANSAEFEPETTHPVISTMADQEDVIAGEADLGGTMRLGAYPAVL
FT                   AKGSVVARAYGSEEVSERHRHRYEVNNAYRDRIAKSGLRFSGTSPDGHLVEFVEYPADQ
FT                   HPFFVATQAHPELKSRPTRPHPLFAAFVDAALRHKLEERLPVDVHGEERAAADDEIAES
FT                   ADRDEVASVDSAG"
     ttgccacagt cacgcactca ttcgcgtacc gccaccaagc acatcttcgt gagcggcggc        60
     gtcgcctcct cactcggcaa gggcctcaca gcctcgagcc tcgggcagtt gctgaccgcg       120
     cggggaatgc gcgtgaccat gcagaaactg gatccgtacc tcaatgtcga tccgggcacg       180
     atgaacccct tccagcacgg tgaggtcttc gtcaccgagg acggcgccga gaccgacctc       240
     gacgtcggcc actacgagcg cttcctcgac cgcgacttgt ccggtcaggc gaatgtgacc       300
     accggccagg tgtattcgac ggtcatcgcc aaggagcggc gcggcgaata cctcggcgac       360
     accgtgcagg tcattccgca catcacggac gagatcaaga gccgcatcct cgcgatgagc       420
     gggccggatc tgcagggaca ccgccccgac gtcgtcatca cggagatcgg cggcaccgtc       480
     ggcgacatcg agtcgcagcc gttcctcgag gccgcccgtc aggtccgtca cgacgtcggc       540
     cgggacaacg tcttcttcct ccacgtctcc ctggtcccgt acctggcgcc gtcgggggag       600
     ctcaagacca agcccaccca gcattcggtt gccgcgctgc ggaacatcgg catccagccc       660
     gacgcgctga tcctgcgctg cgaccgggag gttccgccgg cgctgaagaa caagatcgcg       720
     ctcatgtgcg acgtcgacgt cgacggttgc atctcgaccc ccgacgcgcc gtcgatctac       780
     gacatcccga aggtgctgca cagcgagggc ctcgacgcat atgtcgttcg tcagctgggc       840
     ctgccgttcc gcgacgtgga ctggaccgtg tggggaaacc tgctcgagcg cgtccaccag       900
     ccgcgcgaga ccgtgcggat cgccctggtc ggaaaatacg tcgacctgcc ggacgcgtac       960
     ctgtccgtca ccgaggcgct gcgtgcgggc gggttcgcga accgctcgaa ggtggagatc      1020
     tcgtgggtgc cgtccgacgc gtgtgagacc gaggcgggtg cgcaggccgc gctcggcgac      1080
     gtcgacggcg tgctgatccc cggtggcttc ggaatccgcg gcatcgaggg caagctcggt      1140
     gcgatccggt acgcccgcca ccggaagacg cccctgctgg gactgtgcct gggtctgcag      1200
     tgcgtcgtga tcgaagccgc gcgcagcgtg ggtctggacg acgccaactc cgccgagttc      1260
     gagcccgaga ccacgcaccc cgtgatctcc acgatggccg atcaggaaga cgtcatcgcc      1320
     ggcgaggccg acctgggcgg cacgatgcgt ctcggcgcgt acccggccgt cctggcgaag      1380
     ggatccgtcg tcgcccgggc gtacggcagc gaagaggtgt ccgaacggca ccgtcaccgc      1440
     tacgaggtca acaacgcata ccgggaccgg attgccaaga gcggactccg gttcagcggc      1500
     acctcgcccg acggtcacct cgtcgagttc gtcgagtacc cggccgacca gcatccgttc      1560
     ttcgtcgcga cgcaggccca ccccgagctg aagagccgtc cgacgcgtcc gcatccgctg      1620
     ttcgcggcgt tcgtcgacgc ggcgctgagg cacaagctcg aggagcgcct tcccgtcgac      1680
     gtgcacggtg aggagcgcgc ggccgccgac gacgagatcg ccgagtccgc cgaccgcgac      1740
     gaggtcgcgt cggtcgacag cgcgggatag                                       1770
//

If you have problems or comments...

PBIL Back to PBIL home page