(data stored in ACNUC7421 zone)

EMBL: AP011115.RECN

AP011115.RECN        Location/Qualifiers
FT   CDS_pept        complement(690459..692231)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="recN"
FT                   /locus_tag="ROP_06670"
FT                   /product="DNA repair protein RecN"
FT                   /note="protein synonym:recombination protein N"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06670"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48914"
FT                   /db_xref="GOA:C1ASY2"
FT                   /db_xref="InterPro:IPR003395"
FT                   /db_xref="InterPro:IPR004604"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY2"
FT                   /protein_id="BAH48914.1"
FT                   /translation="MLAEIRIDNLGVISEASAQFHEGLTVLTGETGAGKTMVVTSLHLL
FT                   SGARADAGRVRLGAPRAVVEGRFMTDEGSEHVERAVSRLLESTGAERDEDGTIIAVRTV
FT                   GSDGRSRAHLGGRSVPAGVLSEFTDPLLTVHGQNDQLRLLRPDQQCAALDRFADKTVGP
FT                   LVARYRKHRNEWMTARSELIERTGRTRELAQEADQLTFALNEIDGVAPTPGEDEAIVSE
FT                   VRRLSELDSLRSAAEEAHAALAGGDVMDGDGGAAPALDLLSEARARIESATDPELDGLG
FT                   PRLADAIAVVTDVSADLTTYLAGLPADPGALDSLLSRQAELKNLIRKYAADVDGVLEWA
FT                   DNARARLEKIDVSSDALAALTKQVEESAASTAEAASKLTAARVKAATKLAKAVSSELAG
FT                   LAMGRAALEVTVRPRIAGPQDTAPLTVDGTELHAGSSGVDEVEFRLSAHSGAQSLPISK
FT                   SASGGELSRVMLALEVVLAGSDSGATMVFDEVDAGVGGRAAVEIGRRLARLARTHQVIV
FT                   VTHLPQVAAFADTHLVVDKVDDQDGVVSSGVHTLTDDERVVELARMLAGLDDTETGRAH
FT                   AEELLATASAERSA"
     gtgctggcag agatcaggat cgacaacctc ggtgtgatct ccgaggcctc ggcgcagttc        60
     cacgaaggtt tgacggtgct caccggtgag accggtgcgg gcaagacgat ggtggtgacg       120
     agcctgcacc tgctcagcgg tgcgcgggca gacgcgggac gggtgcgcct cggtgcgccg       180
     cgcgccgtcg tcgagggccg gttcatgacg gacgaaggct cggagcacgt cgaacgtgcc       240
     gtgtcccggc tgctcgaatc gaccggtgcc gagcgggacg aggacggcac catcatcgcg       300
     gtccgcaccg tcggcagcga cggcaggtcc cgcgcccacc tgggtgggcg cagtgttccg       360
     gcgggcgtgc tgtccgagtt caccgatccg ctgctcacgg tgcacgggca aaacgatcag       420
     ctgcggctgc ttcgcccgga ccagcagtgc gccgcgctcg atcgattcgc ggacaagacg       480
     gtcgggccgc tggtcgcgcg gtaccgcaaa caccgcaacg agtggatgac cgcgcgatcc       540
     gaactgatcg aacggaccgg tcggacccgg gaactcgcgc aggaagccga ccaactgacg       600
     ttcgctctca acgagatcga cggcgtcgcc cccaccccgg gcgaggacga ggcgatcgtg       660
     tcggaggtcc gcaggctcag cgaactcgac tcgctgcggt cggcggcgga agaagcacac       720
     gcagcgctcg ccggcggcga cgtcatggac ggcgacggcg gggccgcgcc cgcgctggac       780
     ctgctgtccg aggcgcgggc ccggatcgaa tcggccaccg acccggaact cgacgggctc       840
     ggaccccgcc tcgccgacgc gatcgcagtg gtcaccgacg tctccgcgga cctcaccacg       900
     tatctcgccg gactgccggc ggacccggga gcgctggact ctctgctgtc ccggcaggcg       960
     gagctgaaaa acctcatccg caagtacgcc gccgacgtcg acggcgtact ggaatgggcc      1020
     gacaacgccc gtgcgcggct cgagaagatc gacgtgtcct ccgatgcgct ggccgcgctg      1080
     acgaagcagg tggaggagtc ggcggcgtcg accgcggaag cggcgtcgaa actgaccgcg      1140
     gcccgcgtca aggccgcgac caaactcgcc aaggccgtca gttccgaact cgccggtctg      1200
     gcaatgggcc gggcggcgct cgaggtgacg gtccggcccc ggatcgccgg accccaggac      1260
     acggccccgc tcaccgtcga cggcaccgaa ctccacgcgg gatcttccgg cgtcgacgaa      1320
     gtggagttcc ggctgtcggc gcacagcggc gcgcagtcac tgcccatcag caagagcgcg      1380
     tccggcggtg agctctcgcg cgtgatgctc gccctcgagg tggtgctcgc cgggtccgac      1440
     tcgggcgcga cgatggtgtt cgacgaagtc gacgccggcg tcggtggacg ggcggcggtc      1500
     gagatcggca ggcggctggc ccggctggcc cgcacgcacc aggtcatcgt cgtcacgcac      1560
     ctgccgcagg tcgcggcgtt cgcggacacc cacctggtag tcgacaaggt cgacgaccag      1620
     gacggcgtcg tcagcagtgg cgtgcacacg ctcaccgacg acgaacgggt cgtggagctg      1680
     gcccggatgc tcgccggcct cgacgacacg gagaccggtc gcgcgcacgc ggaggagttg      1740
     ctggcgaccg ccagcgccga gcgttccgcc tga                                   1773
//

If you have problems or comments...

PBIL Back to PBIL home page