(data stored in ACNUC7421 zone)

EMBL: AP011115.RPIA

AP011115.RPIA        Location/Qualifiers
FT   CDS_pept        complement(506937..507695)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpiA"
FT                   /locus_tag="ROP_04970"
FT                   /product="ribose-5-phosphate isomerase A"
FT                   /EC_number="5.3.1.6"
FT                   /note="protein synonym:phosphoriboisomerase A"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04970"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48744"
FT                   /db_xref="GOA:C1ARR7"
FT                   /db_xref="InterPro:IPR004788"
FT                   /db_xref="InterPro:IPR020672"
FT                   /db_xref="InterPro:IPR037171"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARR7"
FT                   /protein_id="BAH48744.1"
FT                   /translation="MYTTETPQDAAKYAVGRAAVERYAHDGAQLGLGSGTTSAWFVRAL
FT                   GEKVAEGLDIVGVPTSTATRDLALSVGITLIDLNDLDRPLDVTLDGPDEVDHDGDMIKG
FT                   GGACLLWERMVAEASLKMVCIADDTKLVERLGSFPLPIEVIPFGWKATRRSISALFRDL
FT                   GYTDIDIVQRQRDGQPVVTDSGNFILDAHMVAITDKALLDTNLNWIAGVVENGLFTGIA
FT                   HEILIASPDGAAKLIELPHRRAARIPQWRK"
     atgtacacga ccgaaactcc gcaggacgca gcgaaatacg ctgtcggccg ggccgcggtg        60
     gagcgctacg cgcacgacgg cgcccaactc gggctcgggt ccggaacgac gtccgcgtgg       120
     ttcgtgcgtg ccctcggcga gaaggtcgcc gagggtctcg acatcgtcgg tgttccgacc       180
     tctaccgcaa cccgcgacct ggccctgtcg gtcggcatca ccctcatcga tctcaacgac       240
     ctcgaccgcc cgctcgacgt gacactggac ggacccgacg aggtagacca cgacggtgac       300
     atgatcaagg gcggcggcgc ctgcctgctg tgggaacgga tggtcgccga ggcctcgttg       360
     aagatggtgt gcatcgcaga cgacaccaaa ctggtcgagc ggctcggctc cttcccactc       420
     ccgatcgagg tcatcccgtt cggctggaaa gcaactcggc ggtcgatctc cgcactgttc       480
     cgggacctcg gctacaccga tatcgacatc gtccagcggc agcgggacgg ccagcccgtg       540
     gtcaccgaca gcggcaactt catcctcgac gcccacatgg tcgcgatcac cgacaaggcg       600
     ctgctcgata cgaacctcaa ctggatcgcc ggcgtcgtcg agaacggact gttcaccggc       660
     atcgcccacg agatcctcat cgcctccccg gacggggcgg cgaaactcat cgaactgccg       720
     caccgcaggg cggccaggat cccgcagtgg cgcaaatga                              759
//

If you have problems or comments...

PBIL Back to PBIL home page