(data stored in ACNUC7421 zone)

EMBL: AP011115.RPLT

AP011115.RPLT        Location/Qualifiers
FT   CDS_pept        complement(723351..723740)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rplT"
FT                   /locus_tag="ROP_06920"
FT                   /product="50S ribosomal protein L20"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06920"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48939"
FT                   /db_xref="GOA:C1AT07"
FT                   /db_xref="InterPro:IPR005813"
FT                   /db_xref="InterPro:IPR035566"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1AT07"
FT                   /protein_id="BAH48939.1"
FT                   /translation="MARVKRAVNAQKKRRSILEASSGYRGQRSRLYRKAKEQQLHSLTY
FT                   AYRDRRARKGDFRKLWITRINAAARANDITYNRLIQGLRLAEIEVDRKNLAELAVSDAA
FT                   AFAGLVALAKAALPADVNAPAGEAA"
     gtggcacgcg taaagagggc ggtaaacgcc cagaagaagc gtcgttcgat tctcgaagcc        60
     tccagcggct accgcggaca gcgctcgcgc ctgtaccgca aggccaagga acagcagctc       120
     cactcgctga cctacgccta ccgtgaccgc cgtgcgcgca agggcgactt ccgcaagctg       180
     tggatcacgc gtatcaacgc cgctgcacgg gcgaacgaca tcacgtacaa ccgcctgatc       240
     cagggtctgc gtctggccga gatcgaggtc gaccgcaaga acctcgccga gctggccgtg       300
     tccgacgcgg cggcattcgc cggcctcgtg gccctcgcca aggcggccct tccggctgac       360
     gtgaacgctc ctgccggaga agcggcctga                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page