(data stored in ACNUC7421 zone)

EMBL: AP011115.RPMI

AP011115.RPMI        Location/Qualifiers
FT   CDS_pept        complement(723805..723999)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmI"
FT                   /locus_tag="ROP_06930"
FT                   /product="50S ribosomal protein L35"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06930"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48940"
FT                   /db_xref="GOA:C1AT08"
FT                   /db_xref="InterPro:IPR001706"
FT                   /db_xref="InterPro:IPR021137"
FT                   /db_xref="InterPro:IPR037229"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1AT08"
FT                   /protein_id="BAH48940.1"
FT                   /translation="MPKSKTHSGTAKRFKVSGSGKILRQKAGRRHLLEHKATKVTRRLD
FT                   GVAVVSKADTPRIKRLLDI"
     atgcccaagt cgaagaccca cagcggcacc gcgaagcgat tcaaggtgtc cggcagcgga        60
     aagatcctgc gccagaaggc cggtcgccgc cacctgctcg agcacaaggc caccaaggtg       120
     acccgtcgcc tcgatggcgt ggctgtcgtc agcaaggctg acactcctcg catcaagcgc       180
     ctgctcgaca tctga                                                        195
//

If you have problems or comments...

PBIL Back to PBIL home page