(data stored in ACNUC7421 zone)

EMBL: AP011115.RPMJ

AP011115.RPMJ        Location/Qualifiers
FT   CDS_pept        complement(481378..481500)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpmJ"
FT                   /locus_tag="ROP_04730"
FT                   /product="putative 50S ribosomal protein L36"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_04730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48720"
FT                   /db_xref="GOA:C1ARP3"
FT                   /db_xref="InterPro:IPR000473"
FT                   /db_xref="InterPro:IPR035977"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARP3"
FT                   /protein_id="BAH48720.1"
FT                   /translation="MKVRASLKSLKNQPGSQVVRRRGRVYVINKQNPRFKARQG"
     ttgaaagttc gtgcatcgct caagtctttg aagaatcaac ccggctctca ggtcgtacgc        60
     cgacgcggac gggtgtacgt gatcaataag cagaacccgc gcttcaaagc tcgccagggc       120
     tga                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page