(data stored in ACNUC7421 zone)

EMBL: AP011115.RPSA

AP011115.RPSA        Location/Qualifiers
FT   CDS_pept        complement(741065..742549)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="rpsA"
FT                   /locus_tag="ROP_07090"
FT                   /product="30S ribosomal protein S1"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07090"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48956"
FT                   /db_xref="GOA:C1AT24"
FT                   /db_xref="InterPro:IPR003029"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="InterPro:IPR022967"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT24"
FT                   /protein_id="BAH48956.1"
FT                   /translation="MPSTTVTSPQVAVNDIGSAEDFLAAIDATIKYFNDGDIVEGTIVK
FT                   VDRDEVLLDIGYKTEGVIPSRELSIKHDVDPNEVVSVGDEVEALVLTKEDKEGRLILSK
FT                   KRAQYERAWGTIEELKEKDEAVKGTVIEVVKGGLILDIGLRGFLPASLVEMRRVRDLQP
FT                   YVGKEIEAKIIELDKNRNNVVLSRRAWLEQTQSEVRSEFLHQLQKGQVRKGVVSSIVNF
FT                   GAFVDLGGVDGLVHVSELSWKHIDHPSEVVEVGTEVTVEVLDVDLDRERVSLSLKATQE
FT                   DPWRQFARTHAIGQIVPGKVTKLVPFGAFVRVEEGIEGLVHISELAERHVEVPDQVVGV
FT                   NDDALVKVIDIDLERRRISLSLKQANEDYNAEFDPSKYGMADSYDEQGNYIFPEGFDPE
FT                   TNEWLEGFDKQREEWENRYAEAERRHKMHTAQMEKTAADEAAEAATAAAGYSSESGAGD
FT                   ADAASSSSSSSSESAGGSLASDAQLAALREKLSGNA"
     atgccctcca ccaccgtgac ctcgccgcag gtagccgtca acgacatcgg ctccgccgag        60
     gacttcctcg ccgccatcga cgcaacgatc aagtacttca acgatggcga catcgtcgaa       120
     ggcaccatcg tcaaggtcga tcgcgacgag gtcctgctcg acatcggtta caagaccgaa       180
     ggcgtcatcc cttcccgtga gctctccatc aagcacgacg tcgaccccaa cgaggtcgtc       240
     tccgtgggcg atgaggtcga agctctcgtc ctcaccaagg aggacaagga aggccgactg       300
     atcctgtcga agaagcgcgc tcagtacgag cgtgcctggg gcaccatcga ggagctcaag       360
     gagaaggacg aggccgtcaa gggcaccgtc atcgaggtcg tcaagggcgg cctgatcctc       420
     gacatcggcc tgcgtggctt ccttcccgct tcgctcgtcg agatgcgccg tgtccgcgac       480
     ctccagccgt acgtcggcaa ggagatcgag gccaagatca tcgagctcga caagaaccgc       540
     aacaacgtcg tcctctcgcg ccgcgcatgg ctcgagcaga cgcagtccga ggttcgcagc       600
     gagttcctgc accagctgca gaagggccag gtccgcaagg gcgtcgtgtc ctccatcgtc       660
     aacttcggtg ccttcgtgga cctgggcggc gtcgacggcc tggtgcacgt gtccgagctg       720
     tcctggaagc acatcgacca cccgtccgag gttgtcgagg tcggcaccga ggtcacggtc       780
     gaggttctcg acgtcgacct ggaccgcgag cgcgtctccc tctcgctcaa ggccacgcag       840
     gaagacccgt ggcgtcagtt cgcccgcacg cacgccatcg gccagatcgt gcccggcaag       900
     gtcacgaagc tggttccgtt cggtgccttc gtgcgcgtcg aagagggaat cgaaggcctc       960
     gtccacatct ccgagctggc cgagcgccac gtggaggtcc cggaccaggt cgtcggtgtc      1020
     aacgacgacg cactcgtcaa ggtcatcgac atcgacctcg aacgtcgtcg catctcgctg      1080
     tcgctgaagc aggccaacga ggactacaac gccgagttcg atccgtccaa gtacggcatg      1140
     gcggacagct acgacgagca gggcaactac atcttccccg agggcttcga tcccgagacc      1200
     aacgaatggc tcgagggctt cgacaagcag cgggaagagt gggagaaccg ctacgccgag      1260
     gctgagcgtc gtcacaagat gcacaccgct cagatggaga agaccgctgc agacgaggcc      1320
     gccgaggctg ccactgctgc tgccggctac tcctccgagt cgggtgccgg cgacgccgac      1380
     gccgcttcgt cctccagctc ctcgtcgtcc gagtcggccg gtggatcgct ggccagcgac      1440
     gcacagctcg ccgctctgcg cgagaagctg tcgggcaacg cctag                      1485
//

If you have problems or comments...

PBIL Back to PBIL home page