(data stored in ACNUC7421 zone)

EMBL: AP011115.SCPB

AP011115.SCPB        Location/Qualifiers
FT   CDS_pept        complement(682912..683604)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="scpB"
FT                   /locus_tag="ROP_06600"
FT                   /product="chromosome segregation and condensation protein
FT                   ScpB"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06600"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48907"
FT                   /db_xref="GOA:C1ASX5"
FT                   /db_xref="InterPro:IPR005234"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASX5"
FT                   /protein_id="BAH48907.1"
FT                   /translation="MSSAPFDEPDDQGAVDTEPELSDTELAAVLESLLLIVDSPAGAEQ
FT                   LASATGASVNRITETLNRMSAELTARGSGMDLRYAGDGWRLYTRTAYAPYVERLLLDGA
FT                   RSKLTRAALETLAVVAYRQPLTRARISAVRGVNVDGVVRTLLARGLIAEAGVDPDTNAT
FT                   QYSTTELFLERLGLASLADLPALAPLLPDVDLIDDISDSLESDPRFARMNKATASTEEL
FT                   DTGLDTED"
     atgagttcgg ccccgttcga cgagccggac gatcagggtg ccgtcgacac ggaacccgag        60
     ctgtcggaca ccgaactcgc ggctgttctc gagtcgttgc tgctgatcgt cgactctccg       120
     gccggtgcgg agcagctcgc gtccgcgacc ggcgcttctg tgaatcgcat cacggagacg       180
     ctgaatcgca tgtccgccga gctcaccgcc cgcggaagcg ggatggacct ccgatatgcc       240
     ggtgacggtt ggcgtctcta cacccgcacc gcgtacgcgc cctacgtgga acggctcctg       300
     ctcgacggtg cccgctccaa actgacgagg gcggctttgg aaactctggc cgtggtggca       360
     taccgtcaac cgttgacccg cgcacggatc agtgcggtgc gcggcgtcaa cgtggatggt       420
     gtggtgcgca cacttctcgc tcgcgggttg atcgccgaag ccggcgtcga tcccgatacc       480
     aacgccacgc agtattcgac gacggaactc tttctggaac ggctcggctt ggcgtctctg       540
     gccgatcttc ccgccttggc tccgttgttg ccggatgtgg acctgataga tgacatcagt       600
     gacagtctgg aatctgaccc acgatttgcg agaatgaata aagctacggc ttccacagaa       660
     gagttggaca ccgggctgga caccgaagac tga                                    693
//

If you have problems or comments...

PBIL Back to PBIL home page