(data stored in ACNUC7421 zone)

EMBL: AP011115.TATA

AP011115.TATA        Location/Qualifiers
FT   CDS_pept        complement(594214..594495)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatA"
FT                   /locus_tag="ROP_05750"
FT                   /product="Sec-independent protein translocase protein TatA"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05750"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48822"
FT                   /db_xref="GOA:C1ARZ5"
FT                   /db_xref="InterPro:IPR003369"
FT                   /db_xref="InterPro:IPR006312"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ARZ5"
FT                   /protein_id="BAH48822.1"
FT                   /translation="MGAMSPWHWAIVALVVVILFGSKKLPDAARGLGRSLRIFKSEVKE
FT                   MQNDNSTPAPTAQQSAPAELPVADTTTAPVTPPAPVQPQPQHTEPKSA"
     atgggagcca tgagcccctg gcactgggcc atcgtcgcgc tggtcgtcgt catcctgttc        60
     ggttccaaga agctgcccga tgcggctcgt ggactcggcc gttcgctccg catcttcaag       120
     agcgaggtca aggagatgca gaacgacaac agcacgccgg cgcccaccgc gcagcagagc       180
     gcgcccgccg agctgcccgt ggcggacacc accaccgcac cggtcacccc tccggcgccg       240
     gtgcagccgc agccgcagca caccgagccc aagtcggcgt ag                          282
//

If you have problems or comments...

PBIL Back to PBIL home page