(data stored in ACNUC7421 zone)

EMBL: AP011115.TATC

AP011115.TATC        Location/Qualifiers
FT   CDS_pept        complement(593102..594142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tatC"
FT                   /locus_tag="ROP_05740"
FT                   /product="Sec-independent protein translocase protein TatC"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_05740"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48821"
FT                   /db_xref="GOA:C1ARZ4"
FT                   /db_xref="InterPro:IPR002033"
FT                   /db_xref="InterPro:IPR019820"
FT                   /db_xref="UniProtKB/TrEMBL:C1ARZ4"
FT                   /protein_id="BAH48821.1"
FT                   /translation="MRIPFDPRHSKRRTNPDGTMSLVDHLYELRTRLLLSVLAIVVTTA
FT                   VGFFWYSHQIFGIESLGELLRGPYCSLPESSRADLSNDGSCRLLATGPFEQFMLRFKVA
FT                   LTAGVVLACPIWLYQLWAFITPGLYAKERRYAIGFVVSGAALFIAGAVLAYVVVAKALH
FT                   FLLTIGDNVQITALGGAEYFGFIINLLIIFGVSFEIPLLIVALNFVGILPYAKLKAWRR
FT                   GLIFALFVFAAIATPGQDPFSMLALAFALTLLFEIAVQIARINDRRKARRTEQEWGALD
FT                   DDEASTIAAPADLNESFDVAAATVPESAGRFRRSRKSGKSGAANKNDAASTTGSNTPGQ
FT                   DFSDTL"
     gtgcgaattc cgttcgatcc gcgccacagc aagcggagga ccaaccccga cggcaccatg        60
     tcgttggtcg atcacctcta cgagctgcgc acgcgactgc tcctgtcggt gctggccatc       120
     gtggtcacca cagcggtggg attcttctgg tactcccacc agatcttcgg catcgagagt       180
     ctcggcgagc tcctgcgcgg accgtactgt tcgctgccgg agtcgagccg cgccgacctg       240
     agcaacgacg ggtcgtgccg actcctcgcg accggaccgt tcgagcagtt catgctccgc       300
     ttcaaggtcg cgctcacggc gggcgtcgtc ctcgcctgcc ccatctggct gtaccagctg       360
     tgggcgttca tcacacccgg cctgtacgcg aaggaacgcc gctacgcgat cggcttcgtg       420
     gtgtccggcg cggcgctgtt catcgccggt gccgtcctgg cctacgtggt cgtcgcgaag       480
     gccctgcact tcctgctgac gatcggcgac aacgtccaga tcaccgcact cggcggcgcg       540
     gaatacttcg ggttcatcat caacctgctg atcatcttcg gtgtcagctt cgagatcccg       600
     ctgctcatcg tcgccctgaa cttcgtcggt atcctgccct acgcgaaact caaggcgtgg       660
     cgtcgtggcc tgatcttcgc cctgttcgtg ttcgccgcga tcgccacccc cggtcaggac       720
     ccgttctcga tgctcgcgct cgcgttcgcg ttgaccctgc tgttcgagat cgccgtgcag       780
     atcgcccgca tcaacgaccg ccgcaaggct cgtcgcacgg agcaggagtg gggtgccctc       840
     gacgacgacg aggcgtcgac gatcgcggcg ccggccgacc tgaacgagtc cttcgacgtg       900
     gccgccgcaa ccgtccccga gtccgcgggc cggttccggc gttcacgcaa gtccgggaag       960
     tccggtgccg cgaacaagaa cgacgctgcg agcacgaccg gcagcaacac accgggtcag      1020
     gacttctccg acaccctgtg a                                                1041
//

If you have problems or comments...

PBIL Back to PBIL home page