(data stored in ACNUC7421 zone)

EMBL: AP011115.TESB

AP011115.TESB        Location/Qualifiers
FT   CDS_pept        complement(765798..766676)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tesB"
FT                   /locus_tag="ROP_07320"
FT                   /product="acyl-CoA thioesterase"
FT                   /EC_number="3.1.2.-"
FT                   /note="protein synonym:thioesterase II"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07320"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48979"
FT                   /db_xref="GOA:C1AT47"
FT                   /db_xref="InterPro:IPR003703"
FT                   /db_xref="InterPro:IPR029069"
FT                   /db_xref="InterPro:IPR042171"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT47"
FT                   /protein_id="BAH48979.1"
FT                   /translation="MSEVAAKTDLQTLLELLDLEKTGEDTYRGRHPAQVGSRTFGGQLI
FT                   SQALVAAGRTVSGERAVHAVNAHFIRGGDVKEPIEYRVERHRDGRAFANRQVTALQNGQ
FT                   ELFVMLAAFQDWGKGLEHAVEVPDVPFPDTLPPLGDHFQGYEDRLKMFVDALKPIDMRY
FT                   ANDPSWIMKGTGEKLTHNRVWMKSDGDLPDDPLIHVAVMGYSSDTTVLDSIITTHGLSW
FT                   GLDRIVAATVNHSIWFHRPFRFDDWTLYATESPVAAGSRGLATGRFFSLEGELLATVVQ
FT                   EGLIRHFPPRQ"
     gtgagcgaag tcgcggcgaa gaccgatctc cagaccctgc tcgaacttct cgatctcgag        60
     aagaccggcg aggacacata ccgaggtcgg catcccgcgc aggtgggtag ccggacgttc       120
     ggcggccagt tgatctccca ggcactggtc gccgccggcc gcaccgtcag cggcgaacgc       180
     gccgtgcacg ccgtcaacgc ccacttcatc cgcggcggcg acgtcaagga acccatcgaa       240
     taccgcgtcg agcggcaccg cgacggccgg gcgttcgcga atcgccaggt caccgcgctg       300
     cagaacggtc aggaactgtt cgtcatgctg gcggcgttcc aggactgggg caagggtctc       360
     gagcatgcgg tcgaggtacc cgacgtcccg ttcccggaca cgctgccgcc gctcggcgac       420
     cacttccagg gttacgaaga ccggttgaag atgttcgtcg acgcgctcaa gccgatcgac       480
     atgcggtacg cgaacgaccc gtcgtggatc atgaagggca ccggggagaa actcacccac       540
     aaccgggtct ggatgaaatc ggacggcgac cttccggacg acccgctcat ccacgtggcc       600
     gtcatgggct actcgtcgga caccacggtc ctggactcca tcatcaccac ccacggtctg       660
     tcgtggggac tggaccggat cgtcgcggcc accgtgaacc attccatctg gttccaccgg       720
     ccgttccgct tcgacgactg gacgttgtac gccaccgaat cgccggtcgc ggcaggatcc       780
     cgcggtctcg cgacggggcg attcttctcc ctcgaggggg agttgctggc caccgtggtc       840
     caggaggggc tcatccggca cttcccgccg cggcaatag                              879
//

If you have problems or comments...

PBIL Back to PBIL home page