(data stored in ACNUC7421 zone)

EMBL: AP011115.TYRS

AP011115.TYRS        Location/Qualifiers
FT   CDS_pept        complement(702246..703523)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="tyrS"
FT                   /locus_tag="ROP_06730"
FT                   /product="tyrosyl-tRNA synthetase"
FT                   /EC_number="6.1.1.1"
FT                   /note="protein synonym:TyrRS"
FT                   /note="protein synonym:tyrosine--tRNA ligase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06730"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48920"
FT                   /db_xref="GOA:C1ASY8"
FT                   /db_xref="InterPro:IPR001412"
FT                   /db_xref="InterPro:IPR002305"
FT                   /db_xref="InterPro:IPR002307"
FT                   /db_xref="InterPro:IPR002942"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="InterPro:IPR024088"
FT                   /db_xref="InterPro:IPR024107"
FT                   /db_xref="InterPro:IPR036986"
FT                   /db_xref="UniProtKB/TrEMBL:C1ASY8"
FT                   /protein_id="BAH48920.1"
FT                   /translation="MTENIIDELTWRGLIAQSTDLDALRRDLDAGPVTLYAGFDPTGPS
FT                   LHAGHLVPLLALKRFQRAGNRPIVLAGGATGLIGDPRDVGERTMNSADTVAEWADRIRG
FT                   QLERFVDFDDSPSGAVIENNMNWTGKLSAIDFLRDVGKHFSVNVMLARDTVKRRLETDG
FT                   MSYTEFSYMLLQANDYLHLRRSHGCSLQVGGSDQWGNIIAGVELNRRVDAASVHGLTVP
FT                   LVTSADGKKFGKSTGGGSLWLDPEMTSPYAWYQYFVNTGDADVIKYLRWFTFLSAEELA
FT                   ELETATAERPHAREAQRRLAAEMTTLVHGEANTRAVELASQALFGRAELQDLDEPTLGA
FT                   ALREASVAELAPGEPSSIVDLLVLSGLCESKGAARRAVKEGGASVNNQKISSEDWTPES
FT                   GDLLHGTWLVVRRGKRNFAGVKVLSN"
     gtgactgaga acatcatcga tgaactgacc tggcgcgggc tcattgccca atcaaccgat        60
     ctggacgcgc tgcgccgtga tctcgacgcc ggaccggtca cgctctatgc cggtttcgat       120
     ccgactggac cgagtctgca cgctggccat ctcgtgccac tgctcgcgct gaagcgattc       180
     cagcgcgcgg gcaaccgccc catcgtgttg gccggtggcg cgaccggtct gatcggcgat       240
     ccccgcgacg tcggtgaacg cacgatgaac tccgccgaca ccgtagcgga atgggccgac       300
     cggatccggg gtcagctcga acggttcgtc gacttcgacg actcgccgag cggcgctgtg       360
     atcgagaaca acatgaactg gaccggcaag ctgtcggcca tcgacttcct ccgcgacgtg       420
     ggcaagcact tctccgtcaa cgtgatgctc gcgcgagaca ccgtgaagcg gcgcctcgaa       480
     acggacggca tgtcctacac cgagttcagc tacatgctgc tccaggccaa cgactacctg       540
     cacctgcgac gcagccacgg ttgttcgctg caggtcggcg gatccgatca gtggggcaac       600
     atcatcgccg gcgtcgagct gaaccggcgc gtcgacgcag cgtcggttca cggtctgacc       660
     gtcccgctcg tcacgtcggc ggacggcaag aagttcggca agtcgaccgg aggcggaagc       720
     ctgtggctcg accccgagat gacgagcccc tacgcgtggt accagtactt cgtgaacacc       780
     ggcgacgccg acgtgatcaa gtacctgcgg tggttcacgt tcctttccgc ggaggaactg       840
     gcggaactgg agacggcgac cgccgagcgc ccgcatgcgc gcgaggccca gcgcaggctc       900
     gctgcggaga tgacgacact cgtgcacggc gaagccaaca cccgcgctgt ggagctcgcg       960
     agccaggcac tgttcgggcg cgcggaactg caggacctgg acgagccgac gctcggcgcc      1020
     gcacttcggg aggcgtccgt cgcggaactc gccccgggag agccgtccag catcgtcgac      1080
     cttctcgttc tcagcggact gtgcgagagc aagggcgcgg cccgtcgcgc cgtgaaggaa      1140
     ggcggcgcct ccgtcaacaa ccagaagatc tccagtgagg actggacgcc cgaatcgggt      1200
     gatctgctgc acgggacgtg gctcgtggtt cggcgcggaa agcgcaactt cgccggcgtc      1260
     aaagtgctgt cgaactag                                                    1278
//

If you have problems or comments...

PBIL Back to PBIL home page