(data stored in ACNUC7421 zone)

EMBL: AP011115.UPP

AP011115.UPP         Location/Qualifiers
FT   CDS_pept        complement(401256..401885)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="upp"
FT                   /locus_tag="ROP_03870"
FT                   /product="uracil phosphoribosyltransferase"
FT                   /EC_number="2.4.2.9"
FT                   /note="protein synonym:UMP pyrophosphorylase"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48634"
FT                   /db_xref="GOA:C1ARF7"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005765"
FT                   /db_xref="InterPro:IPR029057"
FT                   /db_xref="InterPro:IPR034332"
FT                   /db_xref="UniProtKB/Swiss-Prot:C1ARF7"
FT                   /protein_id="BAH48634.1"
FT                   /translation="MGTVHLIDHPLVQHKLTMMRRKDASTNSFRRLANEISALMTYEVL
FT                   RDIPMQEIEIETPLEVTTGRVIDGKKLVFVSILRAGTGILDGMLTIVPGARVGHIGLYR
FT                   DPRTLVAVEYYFKMPGDLHERDVVVVDPLLATGNSAVAAVERLKECGPKSIKFVCLLTC
FT                   PEGVAALDKAHPDVPIYTAAVDRQLDEHGYILPGIGDAGDRIFGTK"
     atggggacag tacacctgat cgaccacccg ctggtgcagc acaagctcac gatgatgcgc        60
     cgtaaggatg cctccaccaa cagttttcgc cgactggcga acgagatctc cgcgctgatg       120
     acgtatgagg tgctgcgcga catcccgatg caggagatcg agatcgagac gccgctcgag       180
     gtcacgaccg gcagggtcat cgacgggaag aagctggtct tcgtgtccat cctgcgcgcg       240
     ggcaccggca tcctggacgg catgctgacg atcgtgccgg gcgcgcgggt ggggcatatc       300
     ggtctgtacc gcgaccccag gaccctcgtg gcggtcgagt actacttcaa gatgcccggc       360
     gacctgcacg agcgcgacgt ggtggtggtc gatccgctgc tggccaccgg taactccgcg       420
     gtggcggcgg tggagcggct gaaggagtgc ggtcccaaat ccatcaaatt cgtctgcctg       480
     ctgacctgtc cggaaggcgt tgccgcgctg gacaaggcgc atcccgacgt gccgatctac       540
     actgccgccg tcgaccgtca actcgacgag cacggctaca tcctccccgg catcggcgac       600
     gcaggtgacc gcatcttcgg caccaaatag                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page