(data stored in ACNUC7421 zone)

EMBL: AP011115.UVRA

AP011115.UVRA        Location/Qualifiers
FT   CDS_pept        complement(727536..730529)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrA"
FT                   /locus_tag="ROP_06990"
FT                   /product="UvrABC system protein A"
FT                   /note="protein synonym:excinuclease ABC subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_06990"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48946"
FT                   /db_xref="GOA:C1AT14"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR004602"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041102"
FT                   /db_xref="InterPro:IPR041552"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT14"
FT                   /protein_id="BAH48946.1"
FT                   /translation="MADRLIVRGAREHNLRGVDLDLPRDSLIVFTGLSGSGKSSLAFDT
FT                   IFAEGQRRYVESLSAYARQFLGQMDKPDVDFIEGLSPAVSIDQKSTNRNPRSTVGTITE
FT                   VYDYLRLLYARAGTAHCPVCGEQIARQTPQQIVDQVLEMEEGTRFQVLAPVVRTRKGEF
FT                   VDLFDQLNMQGYSRVRVDGVVYPLSEPPKLKKQEKHDIEVVVDRLTVKAGSKQRLTDSV
FT                   ETALRLAEGIVVLDFVDREENAADRERRFSEKLACPNGHALSIDDLEPRSFSFNSPYGA
FT                   CPECTGLGIRKEVDPDLVVPDPELSLGDGAIAPWSMGQSSEYFGRLLSGLGDILGFDMK
FT                   TPWNKLPAKARRAILEGSEEQVHVRYKNRYGRTRSYYAEFEGVMPFLHRRLEQTESDQM
FT                   KERYDGYMRDTPCPACGGARLRPEILSVTIANEKFGMKSIAEVCELSISDCADFLNSLT
FT                   LGSREEAIAGQVLKEVQARLGFLLDVGLEYLSLARAAGTLSGGEAQRIRLATQIGSGLV
FT                   GVLYVLDEPSIGLHQRDNRRLIETLTRLRDLGNTLIVVEHDEDTIRTSDWVVDIGPLAG
FT                   EHGGKVVHSGPYQELLDCEESLTGAYLSGRSHIEIPAIRRPVDRKRQVTVVGAREHNLG
FT                   GIDVSFPLGVLTSVTGVSGSGKSTLVNDILATVMANKLNGARQVPGRHTRINGLDQLDK
FT                   LVQVDQSPIGRTPRSNAATYTGVFDKIRTLFAATTESKVRGYQPGRFSFNVKGGRCEAC
FT                   SGDGTLKIEMNFLPDVYVPCEVCHGARYNRETLEVHYKGKTIAEVLDMPIEEAAEFFEP
FT                   ITSIHRYLKTLVEVGLGYVRLGQPAPTLSGGEAQRVKLAAELQKRSTGRTVYILDEPTT
FT                   GLHFEDIRKLLGVVNGLVDKGNTVIVIEHNLDVIKTSDWVVDMGPEGGSGGGTVVAQGT
FT                   PEDVAQVPESYTGRFLENVLAVPAPVAAKPKAAKSSPTRKSASAKKTAAATAATPRKRA
FT                   PKKAAAVS"
     gtggcggatc gccttatcgt gcggggtgcc cgtgagcaca atctgcgagg ggtcgatctc        60
     gatctgcccc gggacagcct gatcgtgttc accggactgt cgggctcggg caagtcgagt       120
     ctggcattcg acacgatctt cgccgagggc cagcgacgct acgtcgagtc gctgtcggcg       180
     tacgcgcgac agttcctcgg tcagatggac aagcccgacg tcgacttcat cgaaggtctg       240
     tcgcccgcgg tgtccatcga ccagaagtcg accaaccgga acccgcggtc gacggtcggc       300
     accatcacgg aggtctacga ctacctgcgt ctgctgtacg cgcgcgccgg caccgcacac       360
     tgcccggtgt gcggggagca gatcgcgcgg cagacgccgc agcagatcgt cgaccaggtt       420
     ctcgagatgg aggaaggcac ccgcttccag gtgctcgctc ccgtcgtgcg cacccgcaag       480
     ggtgaattcg tcgacctgtt cgaccagctc aacatgcagg gttactcgcg tgtgcgggtc       540
     gacggcgtgg tgtatccgct gtccgagccg cccaagctca agaagcagga gaagcacgac       600
     atcgaggtgg tcgtcgaccg tctcaccgtc aaggccggtt ccaagcagcg gctcaccgat       660
     tccgtcgaga cggcgctgcg actggcagag ggcatcgtcg tcctcgactt cgtcgaccgc       720
     gaggagaacg ccgccgaccg ggaacgacgg ttctcggaga agctggcgtg ccccaacggc       780
     cacgcactgt ccatcgacga cctcgaaccc cggtcgttct cgttcaactc cccgtacggc       840
     gcctgccccg agtgcaccgg cctcggcatc cgcaaggagg tcgacccgga cctcgtcgtc       900
     cccgaccccg agctgtcact cggggacggg gccatcgcgc cgtggtcgat ggggcagagt       960
     tccgaatact tcggccgcct gctgtccggt ctcggcgaca ttctcggctt cgacatgaag      1020
     acgccgtgga acaagcttcc ggcgaaggcg cgccgggcga tcctcgaggg cagcgaggag      1080
     caggtccacg tccgctacaa aaaccggtac gggcgtaccc gttcctacta cgccgagttc      1140
     gagggcgtca tgccgttcct gcaccgccgg ctcgagcaga ccgagtccga ccagatgaag      1200
     gaacgctacg acggctacat gcgggacacc ccgtgtcccg cgtgcggtgg tgcgcgcctg      1260
     cgccccgaga tcctgtcggt cacgatcgcg aacgagaagt tcgggatgaa atcgatcgcc      1320
     gaggtctgtg aactgtcgat ctccgattgc gccgacttcc tgaacagcct cacgctgggc      1380
     agccgcgagg aggccatcgc cggtcaggtg ctcaaagagg tccaggcccg actcggcttc      1440
     ctcctcgacg tcggcctcga gtacctctcc ctcgcccgcg ccgcaggcac cctgtccggt      1500
     ggtgaggcgc agcgcatccg tctcgccacc cagatcggct cgggtctggt gggcgtcctg      1560
     tacgtgctcg acgagccgtc gatcggtctg caccagcgcg acaaccggcg tctcatcgag      1620
     accctgacgc gcctgcgcga cctcgggaac acgctcatcg tggtcgagca cgacgaagac      1680
     accatccgca cgtccgactg ggtggtcgac atcgggccgc tcgccggcga gcacggcggc      1740
     aaggtcgtcc acagtgggcc gtaccaggaa ctgctcgact gcgaggaatc cctcaccggc      1800
     gcctatctgt cgggacgcag tcacatcgag attcccgcca tccgccgtcc ggtggatcgc      1860
     aagcgccagg tcacggtcgt cggcgcgcgc gaacacaacc tcggcggcat cgacgtcagc      1920
     ttcccgctgg gcgtgctcac gtcggtcacc ggcgtgtccg ggtccggcaa gtcgacgctc      1980
     gtcaacgaca tcctcgcgac ggtgatggcg aacaagctca acggcgcccg tcaggtgccg      2040
     ggccggcaca cccgcatcaa cgggctcgac cagctggaca agctcgtgca ggtcgaccag      2100
     tcacccatcg gccgcacccc gcggtccaac gcggccacct acaccggggt gttcgacaag      2160
     atccgcaccc tgttcgccgc caccaccgag tcgaaggtgc gcgggtacca gccgggccgg      2220
     ttctcgttca acgtcaaggg tggtcgctgc gaggcctgct ccggcgacgg cacgctgaag      2280
     atcgagatga acttcctccc cgacgtgtac gtgccgtgcg aggtctgcca cggtgcccga      2340
     tacaaccgcg agacgctcga ggtccactac aagggcaaga ccatcgccga ggtcctggac      2400
     atgccgatcg aggaggccgc ggaattcttc gagcccatca cctcgatcca ccgctacctc      2460
     aagactctgg tcgaggtcgg tctcgggtat gtgcggctcg gtcagcccgc gcccacgctg      2520
     tccggtggtg aggcgcaacg cgtgaagctc gccgccgaac tgcagaaacg ctcgacgggc      2580
     cgcacggtgt acatcctcga cgagcccacg acgggtctgc acttcgagga catccgcaag      2640
     ctgctggggg tcgtcaacgg cctggtcgac aagggcaaca cggtgatcgt gatcgagcac      2700
     aacctcgacg tgatcaagac gtccgactgg gtggtcgaca tggggcctga gggtgggtcc      2760
     ggcggcggaa ccgtcgtcgc gcaaggcacc ccggaggatg tggcgcaggt tccggagagt      2820
     tacacgggac ggttcctcga gaacgtcctg gcggtgccgg cgcctgttgc ggcgaagccg      2880
     aaggcagcca agtcctcgcc gacgcggaag tccgcgtcgg cgaagaagac tgccgcggcc      2940
     accgcggcga caccgcgtaa gcgcgcgccg aagaaggccg cagccgtcag ctga            2994
//

If you have problems or comments...

PBIL Back to PBIL home page