(data stored in ACNUC7421 zone)

EMBL: AP011115.UVRB

AP011115.UVRB        Location/Qualifiers
FT   CDS_pept        complement(736550..738712)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="uvrB"
FT                   /locus_tag="ROP_07050"
FT                   /product="UvrABC system protein B"
FT                   /note="protein synonym:excinuclease ABC subunit B"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_07050"
FT                   /db_xref="EnsemblGenomes-Tr:BAH48952"
FT                   /db_xref="GOA:C1AT20"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR001943"
FT                   /db_xref="InterPro:IPR004807"
FT                   /db_xref="InterPro:IPR006935"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR024759"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036876"
FT                   /db_xref="InterPro:IPR041471"
FT                   /db_xref="UniProtKB/TrEMBL:C1AT20"
FT                   /protein_id="BAH48952.1"
FT                   /translation="MAFASEHPVVAHSEFRPIGEIERSEARFEVVSDHKPAGDQPTAIA
FT                   DLERRINAGEKDVVLLGATGTGKSATTAWLIEKVQRPTLVMAPNKTLAAQLANELRDML
FT                   PNNSVEYFVSYYDYYQPEAYIAQTDTYIEKDSSINDDVERLRHSATSSLLSRRDVVVVA
FT                   SVSCIYGLGTPQSYLDRSVQLEVGVEVPRDALLRLLVDVQYTRNDLAFTRGSFRVRGDT
FT                   VEIIPSYEELAVRIEFFGDEIEALYYLHPLTGDVVRKVDSVRIFPATHYVAGPERMERA
FT                   VKDIEAELEERLADLENKGKLLEAQRLRMRTQYDLEMIKQVGFCSGIENYSRHIDGRGP
FT                   GTAPATLIDYFPEDFLLVIDESHVTVPQIGAMYEGDMSRKRNLVEFGFRLPSATDNRPL
FT                   TWEEFTQRIGQTVYLSATPGKYELGQAGGEFVEQVIRPTGLVDPEVVVKPTKGQIDDLV
FT                   HEIRERADRDERVLVTTLTKKMAEDLTDYLLELGIRVRYLHSDIDTLRRVELLRQLRLG
FT                   EYDVLVGINLLREGLDLPEVSLVAILDADKEGFLRSSTSLIQTIGRAARNVSGQVHMYA
FT                   DKITDSMQHAIEETERRREKQIAYNEKMGVDPQPLRKKIADILDQVYEEAEDTASGVDV
FT                   GGSGRNATRGRRAQGEAGRSVSAGVYEGRDTKSMPRAELADLVKELTDQMMNAARDLQF
FT                   ELAGRLRDEIADLKKELRGMDAAGLK"
     atggcgtttg catccgagca ccccgtggtg gcacattccg agttccgtcc catcggggag        60
     atcgagcggt cggaggcgcg tttcgaggtc gtcagcgacc acaaaccggc cggcgaccag       120
     ccgactgcga tcgcggatct ggaacggcgc atcaacgcgg gtgagaaaga cgtggtcctg       180
     ctcggcgcca ccggtacggg taagtcggcg accacggcgt ggctgatcga gaaggtgcag       240
     cgacccacgc tggtgatggc gcccaacaag acgctcgccg cgcagttggc caacgagttg       300
     cgcgacatgc tgccgaacaa ctccgtcgag tatttcgtct cgtactacga ctactaccag       360
     cccgaggcgt acatcgcgca gaccgacacc tacatcgaga aggactcgtc gatcaacgac       420
     gacgtcgagc gtttgcggca ctccgcgacg tcgagcctgc tctcgcggcg ggacgtggtc       480
     gtggtggcgt ccgtgtcgtg catctacggc ctcggcactc cgcagtccta cctcgaccgc       540
     tcggtgcagc tcgaggtcgg tgtggaggtg ccgcgcgacg ccctcctgag gttgctggtc       600
     gacgtgcagt acacccgcaa cgacctggcg ttcacccgcg ggtccttccg ggtgcgcggc       660
     gacacggtcg agatcattcc ctcgtacgag gaactggcgg tgcgaatcga gttcttcggc       720
     gacgagatcg aggctctcta ctacctgcac ccactcaccg gggacgtcgt gcggaaggtc       780
     gactcggtgc gcatcttccc ggccacgcac tacgtcgccg gtccggagcg gatggaacgt       840
     gccgtcaaag acatcgaagc cgaactcgag gagcggctcg ccgacctcga gaacaagggc       900
     aagctgctcg aggcgcagcg gctccggatg cgcacccagt acgacctcga gatgatcaaa       960
     caggtcgggt tctgctccgg catcgagaac tactcgcggc acatcgacgg tcgtggaccg      1020
     ggcacggcgc ccgcaacgct gatcgactac ttcccggagg atttcctcct cgtcatcgac      1080
     gagtcgcacg tgacggtccc gcagatcggt gcgatgtacg agggcgacat gtcgcgcaag      1140
     cggaacctgg tcgagttcgg tttccggttg ccgtccgcca ccgacaaccg cccgctgacg      1200
     tgggaggagt tcacccagcg catcgggcag acggtgtatc tgtcggccac acccggcaag      1260
     tacgagctgg ggcaggccgg cggcgagttc gtcgagcagg tcatccgccc gaccgggctc      1320
     gtcgatcccg aggtggtcgt caaaccgacc aagggacaga tcgacgacct ggtgcacgag      1380
     atccgtgaac gcgcggaccg cgacgagcgt gttctcgtca ccacgttgac gaagaagatg      1440
     gcggaagacc tcaccgacta cctcctcgag ctcggtatcc gggtgcgata cctgcactcg      1500
     gacatcgaca cgttgcggcg cgtcgagctg ctccggcagc tgcggctggg ggagtacgac      1560
     gttctggtgg gtatcaacct gctgcgggag ggcctcgacc tacccgaggt ctcgctggtg      1620
     gccatcctcg acgccgacaa ggagggcttc ctccggagtt cgacgagcct catccagacg      1680
     atcggccgtg cggctcgaaa cgtctccggt caggtgcaca tgtacgccga caagatcacc      1740
     gactcgatgc agcacgcgat cgaggagacc gagcggcgtc gtgagaagca gatcgcctac      1800
     aacgagaaga tgggtgtcga tccgcagccg ctgcggaaga agatcgccga catcctcgac      1860
     caggtctacg aggaagccga ggacaccgcc agtggagtcg acgtcggcgg ttccggccgc      1920
     aacgccaccc gtgggcgtcg tgcgcagggc gaggcggggc ggtcggtcag cgccggtgtg      1980
     tacgagggcc gcgacacgaa gtcgatgccg agggcggaat tggccgacct ggtcaaggaa      2040
     ttgaccgatc agatgatgaa cgccgcccgt gatctgcagt tcgaactcgc cgggcggctg      2100
     cgcgacgaga tcgccgatct gaagaaggag ttgcgcggca tggatgccgc gggcctgaaa      2160
     tag                                                                    2163
//

If you have problems or comments...

PBIL Back to PBIL home page