(data stored in ACNUC30630 zone)

EMBL: AP011120.PE1

AP011120.PE1         Location/Qualifiers
FT   CDS_pept        630..1244
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pKNR02-00010"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pKNR02-00010"
FT                   /db_xref="EnsemblGenomes-Tr:BAD95584"
FT                   /db_xref="UniProtKB/TrEMBL:Q564M8"
FT                   /protein_id="BAD95584.1"
FT                   /translation="MREGAREQSAPPKRQNVDLEQGSRVVSCRRGVRRCVLCGRSVGRV
FT                   ATPRSGITRAPGPGCSVACRGSRIVAPPYRSARCRCPGLPSPPPRPIGYALWSHYTRGP
FT                   AGGGLEGSSCITPPERHTPNAFALPEFSSTLVTAVSIVLKKPPDANPIGGFFYARTTFP
FT                   VPRQNTGNATRSISHDCEESRLVYLPNTRGMKKAGTYFGPA"
     atgcgggagg gagcgaggga gcagagcgcg ccccccaaac ggcaaaacgt ggatctcgaa        60
     cagggttcga gggtggtgtc ttgccgtcgg ggggtgcgta ggtgtgtgct ctgcggtcgg       120
     tcggtcggtc gcgtcgctac gccgcgctcg gggattactc gagcgccagg gccggggtgt       180
     tcggtcgcgt gccgggggag ccgcatagtc gcgcccccgt accgctctgc gcgttgtagg       240
     tgtccgggcc tgccttcacc accgccgcga ccgatcgggt atgccctttg gtctcactac       300
     acccgggggc cagccggtgg gggtctggaa gggagttcgt gtatcacgcc acctgagcga       360
     cacaccccca acgctttcgc gctgccagag ttctccagta ccctggtcac tgcagtttcg       420
     atcgttttga aaaagccccc ggacgccaat ccaatagggg gctttttcta tgcccggacc       480
     acctttccag ttcccagaca aaacaccggt aacgccacgc gctcgatttc gcacgactgc       540
     gaagagtccc ggctggtgta tctcccaaac acccggggca tgaaaaaggc cggcacctat       600
     ttcggtccgg cctga                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page