(data stored in ACNUC30630 zone)

EMBL: AP011120.PE2

AP011120.PE2         Location/Qualifiers
FT   CDS_pept        1374..1964
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="ROP_pKNR02-00020"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:ROP_pKNR02-00020"
FT                   /db_xref="EnsemblGenomes-Tr:BAD95585"
FT                   /db_xref="UniProtKB/TrEMBL:Q564M7"
FT                   /protein_id="BAD95585.1"
FT                   /translation="MPASPPSNNPSSGTPASMPGRPRWSASEAARRCGVGRSTIQRALV
FT                   AGRIPDAVETEKGWSIPLDGLLAAGFTPDRPSPPDPTLTSPPNPARGHDRAPTNNDGEH
FT                   ARRIAELELALERERARAELEHARRVAAEQLAAERAERVADLRHTLRMIEAPLAEQLHG
FT                   APEESPVEPPVAPATSTEQAPTLFGLLGRLLNR"
     atgcccgcga gccctccttc gaacaacccg tcttcgggca cgcccgcgag catgcccggg        60
     cggcctcgct ggtccgcttc cgaggcagcc cgccgctgtg gagtcgggcg ctcgaccatc       120
     caacgagcgt tggtcgctgg ccggatcccc gatgcagttg agacggagaa gggctggtcg       180
     atcccattgg acgggcttct ggctgccggc ttcacacctg accgtcccag tcctccagat       240
     ccaacactga ccagcccgcc gaaccccgca cgcgggcatg accgagcacc tacaaacaac       300
     gacggcgagc atgcccgccg gatcgccgag ctggagctgg cgctggaacg cgagcgtgcc       360
     cgagccgagc tggagcacgc tcgccgggtc gcggcggaac aactcgctgc cgaacgcgcc       420
     gaacgtgtcg ccgacctccg acacacactc cgcatgatcg aagcacctct cgccgaacaa       480
     ctgcacggcg ctccggagga gtcgccggta gagccaccag tagcgccggc gacatctacc       540
     gagcaagcac caacgctgtt cggcctgctg ggtcgactgc tcaaccggta g                591
//

If you have problems or comments...

PBIL Back to PBIL home page