(data stored in ACNUC10043 zone)

EMBL: AP011532.ACDA

AP011532.ACDA        Location/Qualifiers
FT   CDS_pept        complement(450240..451616)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="acdA"
FT                   /locus_tag="MCP_0449"
FT                   /product="acetyl-CoA synthetase alpha subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0449"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60521"
FT                   /db_xref="GOA:D1YVP9"
FT                   /db_xref="InterPro:IPR003781"
FT                   /db_xref="InterPro:IPR016102"
FT                   /db_xref="InterPro:IPR032875"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVP9"
FT                   /protein_id="BAI60521.1"
FT                   /translation="MTDSSLNPMLRPRSIAVIGVSREPSKWGYKVFHNIVSNAYKGKAY
FT                   PVNPSTPDIDGIKCYARVGDILGEVDLAIIIVPASAALQVVDECGAKKVKALCVITAGF
FT                   SEVGPDGAVLEEKLKQKAASYGMRMLGPNTMGFVNNSISLNASIVPRMPPKGEISFITQ
FT                   SGALGLSLVDWAIGSNLGMNCVVSTGNKADVSEADLLEFFEQDKGTWTIAMYIEGLKDG
FT                   RKFMEAARKVKKAKLAIKAGVSQAGARAAASHTGSLAGSDAVYDAAFRQCGVVRVEGVE
FT                   EMFDAAMALSTQPKANGNRVAILSNGGGAAIMASDACERRGMKVPELTRHTKAGIARLL
FT                   PAFASVKNPIDTVAKSDYDIYREALKMLIDDKDIDCVMVIYAHAGFTSAAEPARAVIDA
FT                   LKEKYPKPVVACWMGGREVNAVAGMFRRNRVPFYPAPERAAEALSALIRYNGFLKEAGK
FT                   "
     gtgaccgaca gctcgctgaa ccccatgctg aggccccgga gcatcgccgt gatcggcgta        60
     tccagggagc cctccaagtg gggctataag gtttttcata atatcgtcag taatgcctac       120
     aagggcaaag cctatcccgt gaacccctcg acgcccgata tcgacgggat aaaatgctat       180
     gccagggtcg gcgacatact cggagaggtc gatctggcta tcattatagt tccggcgtct       240
     gcggcgctcc aggtcgtgga cgagtgcggg gcgaaaaaag taaaggcttt atgtgtcatc       300
     acggcgggct tcagcgaggt cggccccgac ggggcagtcc ttgaggaaaa gctgaaacaa       360
     aaggccgctt cgtacgggat gcgcatgctg ggcccgaaca ccatgggttt cgtgaacaac       420
     agcatctcgc tcaacgccag catcgtgccc cggatgcccc ccaaaggcga gatatcattt       480
     attacccaga gcggagcgct ggggctctct ttagttgatt gggccatcgg ctccaacctc       540
     ggcatgaact gcgtggtcag cacgggcaat aaggctgacg tttcagaggc cgacctttta       600
     gagttcttcg agcaggataa gggcacctgg acaatcgcca tgtatatcga gggcctgaag       660
     gacggcagga agttcatgga ggccgcccgg aaggtcaaga aggcgaagct ggccatcaag       720
     gcgggcgtga gccaggccgg ggccagggcc gcggcctcgc acacaggaag cctggccggg       780
     tctgatgcgg tttacgatgc agcgttcagg cagtgcggcg tagtcagggt ggaaggcgtg       840
     gaggagatgt tcgatgccgc catggcgctg tccacccagc cgaaggctaa tgggaatcgc       900
     gtagcgatcc tgtcgaacgg cggaggggcg gccatcatgg cgagcgatgc ctgcgagcgc       960
     aggggcatga aagtgcccga gctgaccagg catacgaagg ccggcatagc caggctgctg      1020
     ccggcattcg cctccgtgaa gaaccctatc gatacggtgg cgaagtcgga ctacgatatt      1080
     tacagggagg ccctcaagat gctcatcgac gataaggaca tagactgcgt tatggtgatc      1140
     tatgcgcacg ccgggttcac gagcgccgcc gagcccgcga gggccgtgat cgacgccctc      1200
     aaggaaaagt accccaagcc cgtcgtcgcc tgctggatgg gcggcaggga ggtaaacgct      1260
     gtggccggca tgttccggag gaaccgcgtg ccgttctatc ctgcgcccga gagggcggcg      1320
     gaggcgctga gcgccctgat ccgctataat gggttcctta aggaggctgg gaaatga         1377
//

If you have problems or comments...

PBIL Back to PBIL home page