(data stored in ACNUC10043 zone)

EMBL: AP011532.ATPI-1

AP011532.ATPI-1      Location/Qualifiers
FT   CDS_pept        complement(348402..350426)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="atpI-1"
FT                   /locus_tag="MCP_0344"
FT                   /product="A-type ATP synthase subunit I"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0344"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60416"
FT                   /db_xref="GOA:D1YVE4"
FT                   /db_xref="InterPro:IPR002490"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVE4"
FT                   /protein_id="BAI60416.1"
FT                   /translation="MLEPQRMDRVLIVGTKDVMESTINTLHDLDVFHVEDYTAEGEYFK
FT                   IGKPLKAATSLSEKLLKLRSISSYLGTKSNIQFKEKREKVASDIEKDLGPLEASLTSKM
FT                   NEKSALETGIKDIAHKEDILKPYEALGLPLELLYGYENVAAYVGTVPKDIEPVVKAVTG
FT                   DYELFSAPYEKGYTIALFVPRDAAPKVSESLFKNDFIEIEPLHEKGQPLEIKKALEIRK
FT                   AELKSKLEAVNKDIEEMNKQYSKFILASEELLAIDTQKAEAPLKFATSDNAFIVDGWVP
FT                   VNEFESFKQKMLKATGDRVHVTRVEPEPEAYPRETEAHAVHHEVDAPVKYANPKFMYSL
FT                   QAFIDLYARPRYDEIDPTLIFFIMFPLFYGFILGDIGYGLILLIGGFAVKRMLKYSPGF
FT                   QILTTALIICSVSSIVFGFIFGEFMGFNMAKEGILGFTLPYPHTINIGPIGPFSLPLER
FT                   LFPGGFEHGSYVFGIKDLLVFTCLVGVAQILLGYIFGFRNEYVQHGLKTAILHKGSWML
FT                   ILLGGVSAVWYVFPLMITQSLPTFNVMDPLFLAGAAMFIGGFVLLIMGEGATGILEVPG
FT                   LMTNILSYTRLLAVGMSSVGIAFAVNTMTAMLAASGIIGLIVAVIVFVIGHTVNLVLGI
FT                   IAPGLHALRLHYVEFFMKFYKGGGKIYDPFGYMRKYTED"
     atgctagaac ctcaacgcat ggatagagtc ctcatcgtcg gtaccaaaga cgtaatggaa        60
     tctaccatta acaccctgca tgacctggac gtcttccacg ttgaagatta tacggccgaa       120
     ggggaatact tcaagatcgg caagcccctc aaggccgcca catcgctctc cgaaaagctc       180
     ctgaagctcc gctccataag cagctatctc ggcacgaaga gcaacatcca gttcaaggaa       240
     aagcgcgaga aggtcgcctc ggacatcgag aaggacctgg gcccgctcga ggcctcgctc       300
     acctcgaaga tgaacgagaa gagcgcgctc gagaccggca tcaaggatat cgcccacaag       360
     gaagatatac tgaagcccta cgaggctctc gggcttcccc tggagctgtt atacggctac       420
     gagaacgtcg ccgcgtacgt gggcacggtg ccaaaggaca tcgagcccgt ggtcaaggcc       480
     gtcacgggcg actacgagct attttcagcc ccatatgaaa aaggctatac catcgcattg       540
     ttcgtgcccc gggacgccgc ccccaaagta tcagaatcat tatttaagaa cgattttatc       600
     gagatcgagc cgctgcacga gaaagggcag ccgttggaaa taaaaaaggc gctcgagatc       660
     aggaaggccg agttaaagtc gaagctcgag gcggtcaata aggacatcga ggagatgaac       720
     aagcaatact cgaagttcat cctggcctcg gaagagctgc tcgccatcga cacgcagaag       780
     gccgaggcac cgctgaagtt cgcgacgtcg gacaacgcct tcatcgtaga tggctgggtg       840
     cccgttaacg agttcgaatc attcaagcaa aagatgctga aggcaacggg cgacagggtc       900
     cacgtgacca gggtcgagcc ggagcccgag gcttacccta gagagacgga agcacatgcc       960
     gtacaccacg aagtggacgc gccggtcaag tatgcgaacc cgaagttcat gtactcgctc      1020
     caggcgttca tcgacctgta cgccagacct cgctacgatg agatcgaccc gacgctgata      1080
     ttctttatca tgttcccgct gttctacggg ttcatcctgg gagatatcgg ctatggctta      1140
     atattattga tcggcggatt cgccgtaaag cgcatgctga aatattcccc gggattccag      1200
     atattgacga ccgctttgat catatgcagc gtgtcgtcga tcgtcttcgg gttcatattc      1260
     ggggaattca tgggcttcaa catggccaag gaaggcatcc tgggctttac gctgccctac      1320
     ccgcacacga tcaacatcgg gcccatcggc ccattctcgc tgccgctgga gaggctgttc      1380
     cccggaggct ttgagcacgg ctcgtacgtg ttcggcatta aggacctgct ggtgttcacc      1440
     tgcctggtgg gcgtcgcgca gatcctcctg gggtatattt tcggcttcag gaacgagtac      1500
     gtgcagcacg gcctcaagac ggccatatta cacaagggca gctggatgct catactgctc      1560
     ggcggcgtct ccgccgtctg gtatgtgttc ccgctgatga tcacccagtc gttacccacc      1620
     tttaacgtga tggacccgct gttccttgcg ggcgccgcca tgttcatcgg agggttcgta      1680
     ttacttatca tgggcgaggg ggcgaccgga atactggagg tccccggcct aatgaccaat      1740
     atactgtcct atacccgtct tctggcggtg ggcatgtcct cggtcggcat agcgttcgcg      1800
     gtcaatacga tgactgcgat gctggcggcc agcgggatca tcggccttat agtggcagtg      1860
     atcgtgttcg taataggaca cacagtcaac ctggtgctgg gcattatagc ccccggctta      1920
     cacgcgctca ggttgcatta cgtagaattc ttcatgaaat tctacaaagg cgggggcaag      1980
     atttacgatc catttggata catgagaaaa tacacggagg attaa                      2025
//

If you have problems or comments...

PBIL Back to PBIL home page