(data stored in ACNUC10043 zone)

EMBL: AP011532.CCA

AP011532.CCA         Location/Qualifiers
FT   CDS_pept        74277..75608
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="cca"
FT                   /locus_tag="MCP_0083"
FT                   /product="CCA-adding enzyme"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0083"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60155"
FT                   /db_xref="GOA:D1YUN3"
FT                   /db_xref="InterPro:IPR002934"
FT                   /db_xref="InterPro:IPR008229"
FT                   /db_xref="InterPro:IPR011068"
FT                   /db_xref="InterPro:IPR015329"
FT                   /db_xref="InterPro:IPR042090"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUN3"
FT                   /protein_id="BAI60155.1"
FT                   /translation="MPDELYREVLERIKPSAVEDAHMRSVAHEVIDKLDSEAREHGLDV
FT                   YTIHVGSTARDTWLKGKKDIDIFLMFPPDTPLEKLKEDGLRLAREVSPRFEERYAEHPY
FT                   ITALYKGLDVDLVPCYHVEDAAHIQSAVDRSPFHNTYVLKHIDGLHDEVRLLKQFTRGV
FT                   GVYGSELRTQGFSGYLCELLVLKYGSFDGAVEHGAGFKRGRVIDIEGHMDKSVEHPDPL
FT                   IVIDPVDPKRNVAAALSGQKFCEFVDACRRFLKAPSIDFFFPPAAEPMKKGALEGLLAS
FT                   RGTKLLAITFKTPDIVEDTLYPQLRKAEDSLAKLLERHEFKAYRTDVWSNDRSAIVLEM
FT                   LVWELPAIERHLGPPLDEREHCEKFIEKYPGAYIMGCRYVVDIPRKYDTAVELINAQLK
FT                   SCGLGKHVCASIGQGFEILTNEKTLELGPEFARFLTKFLRAPET"
     ttgcccgatg agctatacag ggaggtgctg gagcgcatca agccctctgc cgtcgaggat        60
     gcccacatgc gaagcgtcgc gcacgaggtc atcgataagc tggactcgga ggcccgggag       120
     catggcctgg acgtctacac gatccacgtg ggctcgacgg cccgggacac ctggctgaag       180
     ggcaagaagg acatcgacat cttcctgatg ttcccgcccg acacgcccct ggaaaagctc       240
     aaggaggacg ggctccggct tgccagggaa gtctcgccca ggttcgagga gcgctacgcc       300
     gagcacccgt acatcacggc cctgtataag ggcctggacg tggacctggt gccgtgctac       360
     cacgtggagg acgccgccca catccagtcg gccgtggaca ggagcccgtt ccacaacacg       420
     tacgtcctga agcacatcga cggcctccac gacgaggtaa ggcttttaaa acagttcacc       480
     aggggagtgg gcgtgtacgg ctccgagctg aggacccagg gcttctcggg atacctgtgc       540
     gagctgctgg tactgaagta cggctccttc gacggcgccg tggagcacgg cgccggcttc       600
     aagcggggca gggtcatcga catcgagggc cacatggata agtccgtcga gcacccggac       660
     cccctcatcg tgatcgaccc cgtggacccg aagaggaacg tggccgcggc gctctccggg       720
     caaaagttct gcgagttcgt ggacgcctgc cgcaggttcc tgaaggcccc gtccatcgac       780
     ttcttcttcc cgccggccgc cgagcccatg aaaaagggcg cgctcgaagg gctgctggcc       840
     tcaaggggca cgaagctcct cgccattacc ttcaaaacgc ccgacatcgt cgaggacacg       900
     ctctaccccc agctcaggaa ggccgaggac tcgctggcaa agctgctgga gcgccacgag       960
     ttcaaggcat accgcaccga cgtctggtcc aacgacagga gcgccatcgt gctcgaaatg      1020
     ctggtatggg agctgcctgc catcgagcgc cacctcgggc cgcccctcga cgagcgggag      1080
     cactgcgaga agttcatcga aaagtacccc ggcgcctaca tcatgggctg ccgctacgtc      1140
     gtggacatac cccgcaagta cgataccgcc gtagagctca tcaacgccca attaaagtcc      1200
     tgcgggctgg gcaagcacgt ctgtgcctcc atcggccagg ggttcgagat cctgacgaac      1260
     gagaagacgc tcgagctggg ccccgagttc gcccggttcc tcacgaagtt cctccgcgcc      1320
     ccggagacct ag                                                          1332
//

If you have problems or comments...

PBIL Back to PBIL home page