(data stored in ACNUC10043 zone)

EMBL: AP011532.ECHD

AP011532.ECHD        Location/Qualifiers
FT   CDS_pept        complement(473774..474109)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echD"
FT                   /locus_tag="MCP_0479"
FT                   /product="Ech hydrogenase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0479"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60551"
FT                   /db_xref="GOA:D1YVS9"
FT                   /db_xref="InterPro:IPR001268"
FT                   /db_xref="InterPro:IPR037232"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS9"
FT                   /protein_id="BAI60551.1"
FT                   /translation="MEAKTVTQAELQGIVNGLKAKDARLITIVGADTGENIEVIYFFHT
FT                   GIGQTENYRIIVPKAGGNEEIESITPIIPAAYIAENELCEMFGVRVKGVPGRFFLHPSV
FT                   NAPLRRK"
     atggaagcga agaccgtcac ccaggccgag ctccagggca tcgttaacgg ccttaaggct        60
     aaggacgccc ggctcatcac catcgtagga gcggacacgg gcgagaacat cgaagtaatt       120
     tacttcttcc ataccggcat cggccagacc gagaactaca ggatcatcgt gccgaaggcc       180
     ggaggcaacg aggagatcga gagcatcacg cccatcatac ccgcggcgta catcgccgag       240
     aacgagctat gcgagatgtt cggcgtacgg gtaaaaggcg tgccgggcag gttcttcctg       300
     cacccgagcg tcaacgcgcc cctccggagg aaatga                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page