(data stored in ACNUC10043 zone)

EMBL: AP011532.ECHF

AP011532.ECHF        Location/Qualifiers
FT   CDS_pept        complement(472247..472684)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="echF"
FT                   /locus_tag="MCP_0477"
FT                   /product="Ech hydrogenase subunit F"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0477"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60549"
FT                   /db_xref="GOA:D1YVS7"
FT                   /db_xref="InterPro:IPR010226"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVS7"
FT                   /protein_id="BAI60549.1"
FT                   /translation="MLKILENIFKNITSKPYTSNYPFTPYQHFPGTRADVTFDGTKCIL
FT                   CQLCQRSCPAECIIIHKEETTVEYLNTQCIRCGYCVRVCPTNAISQNEVYTKPSKERLT
FT                   VYTLVTNENAPIIKKRKAEAAKKAATAEGKPVTDKPEEAKK"
     atgctgaaga tactcgagaa catctttaaa aatatcacaa gcaagccgta cacgtccaat        60
     tacccgttca ccccgtacca gcacttccca ggtacgagag ctgacgttac cttcgacggc       120
     accaagtgca ttttatgcca gttgtgccag cggtcatgcc ccgccgagtg catcatcata       180
     cacaaggagg agacgaccgt cgaatacctg aacacgcagt gcatccgctg cggctactgc       240
     gtccgggtgt gcccgaccaa cgcgatatcc cagaacgagg tctacaccaa gccatcgaag       300
     gagcgcttaa cggtatacac gcttgtgacc aacgagaacg cgcccatcat caagaagcgg       360
     aaggcagagg cggcgaaaaa ggcggcgact gcggagggca agcccgtaac tgacaagccc       420
     gaggaagcta aaaaataa                                                     438
//

If you have problems or comments...

PBIL Back to PBIL home page