(data stored in ACNUC10043 zone)

EMBL: AP011532.EIF2G

AP011532.EIF2G       Location/Qualifiers
FT   CDS_pept        354531..355763
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="eif2g"
FT                   /locus_tag="MCP_0350"
FT                   /product="translation initiation factor 2 gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60422"
FT                   /db_xref="GOA:D1YVF0"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR009001"
FT                   /db_xref="InterPro:IPR015256"
FT                   /db_xref="InterPro:IPR022424"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVF0"
FT                   /protein_id="BAI60422.1"
FT                   /translation="MPQPVVNIGMVGHVDHGKTTLVSALSGVWTDTHSEELKRGISIRL
FT                   GYADCTFYKCTNCNEPECYTSKPECAACGTKDLAPLRTVSFVDSPGHETLMATMLSGAA
FT                   IMDGAVLVIAANEPCPQPQTKEHLMALDIIGIKNVVIAQNKIDIVSREEAIKHYNQIKQ
FT                   FVKGTVAENAPIVPVSAQQNINIDVLIKTIEETIPTPKHDLNKPGIMQVARSFDVNRPG
FT                   TVPAKLNGGVLGGTISQGTFKVKDDIEIRPGRKVEHEGRTRWEPIATSVVKLVYGGDSV
FT                   EEATPGGLLAVGTKLDPSMTKSDALAGQVAGKPGSLPPVWHKFVMKTQLLERVVGVADE
FT                   AAMVKAISTSEPLMLSIGTSTTIGVVTSARKDAAEVALKRPVCAEVGSRIAISRRIGAR
FT                   WRLIGVGVLSS"
     ttgccacaac ccgttgtcaa catcggtatg gtgggccacg tcgaccacgg aaagacgacg        60
     cttgtgagcg ccctttccgg cgtctggacc gacacccata gcgaagaatt aaagagaggc       120
     atatccatca ggctgggata cgccgactgt accttttata aatgtacgaa ctgtaacgag       180
     ccggagtgct acacctcgaa gcctgagtgc gcggcgtgcg gcacaaagga cctggcgccg       240
     ttgaggaccg tgtccttcgt ggactcgccg ggccacgaga cgctcatggc cacgatgctc       300
     tcgggcgccg ccatcatgga cggcgccgtt ttagtgatcg ccgccaacga gccgtgcccc       360
     cagccccaga ccaaggagca cttaatggcg ctggacatca tcggcatcaa gaatgtggtc       420
     atcgcgcaga acaagatcga catcgtgagc cgcgaagagg cgatcaagca ctataaccag       480
     atcaagcagt tcgtgaaggg cacggtggcc gagaacgccc cgatcgtgcc cgtatcagca       540
     cagcagaaca tcaacatcga cgtgctcata aagaccatag aggagaccat cccgaccccg       600
     aagcacgacc tgaacaagcc gggcatcatg caggtggccc gctcctttga cgtcaaccgc       660
     cccggcacag tgccggcgaa gctgaacggc ggagtgctgg gaggcacgat ctcccagggc       720
     actttcaagg tcaaggacga catcgagata cgccccggcc ggaaggtcga gcacgagggc       780
     cgcacgcggt gggagccgat cgcgaccagc gtcgtgaagc tcgtctacgg cggcgactcg       840
     gtggaagagg cgacgcccgg cggcctgctg gccgtcggca cgaagctcga cccctccatg       900
     accaagagcg acgcgctggc cggccaggtg gccggtaagc cagggtcgct gcccccggtg       960
     tggcacaagt tcgtcatgaa gacccagctc ctggagcggg tggtcggcgt ggccgacgag      1020
     gccgcaatgg taaaggccat atccacgagc gagccgctga tgctgagcat cggcacctcc      1080
     acgaccatcg gcgtcgtcac gtccgccagg aaggatgcgg ccgaagtggc cctcaagcgg      1140
     ccggtctgtg ccgaagtggg ctcccgcatc gccatcagcc ggcgtattgg cgcccgctgg      1200
     aggctcatcg gcgtaggagt actgtccagt tga                                   1233
//

If you have problems or comments...

PBIL Back to PBIL home page