(data stored in ACNUC10043 zone)

EMBL: AP011532.GATD

AP011532.GATD        Location/Qualifiers
FT   CDS_pept        complement(114465..115709)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gatD"
FT                   /locus_tag="MCP_0119"
FT                   /product="glutamyl-tRNA(Gln) amidotransferase subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0119"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60191"
FT                   /db_xref="GOA:D1YUR9"
FT                   /db_xref="InterPro:IPR006033"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR011878"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="InterPro:IPR027473"
FT                   /db_xref="InterPro:IPR027474"
FT                   /db_xref="InterPro:IPR027475"
FT                   /db_xref="InterPro:IPR036152"
FT                   /db_xref="InterPro:IPR037152"
FT                   /db_xref="InterPro:IPR037222"
FT                   /db_xref="InterPro:IPR040918"
FT                   /db_xref="InterPro:IPR040919"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR9"
FT                   /protein_id="BAI60191.1"
FT                   /translation="MADYKEGDMVRVSSKGREYSGIVMPSRSDKIVLKMKSGYNAGLSL
FT                   DGADVTVVERSPQPPKPARKAHPHNPGLPNISILSTGGTIASRVDYRTGAVSSQFTADD
FT                   ILDAIPELGDMANFNGRVLSMIFSEDMDASVWQNLARACHEEIKNGADGIIVTHGTDTL
FT                   SYTAAALSFMVRSPVPIVLVGAQRSSDRPSSDNAMNMICATAVSTSDIAGVTVVMHGET
FT                   SDDFCYVHRGTKVRKLHTSMRTAFQSVNVPPIARVDYATRKITPITGYVKRGEQELKLM
FT                   GDMETKCALVKFYPGMSPEIIDYYREKSFKGLVLEGTGLGHVSTKWLPAIEKAVSAGIT
FT                   IVMTSQCINGRICDRVYSTGIDLLKAGAIEGEDMLPEVALVKLMWALGQTNDMAQVKRI
FT                   MQHDYAGEIHWRSTV"
     atggcggact acaaggaagg ggacatggtc agggtctcca gcaaaggaag agagtacagc        60
     ggcatcgtga tgccctcccg gagcgacaag atcgtgctga agatgaagag cggctacaac       120
     gcgggcctgt ccctggacgg cgccgacgtg acggtggtag agcgctcccc ccagcctccg       180
     aagcccgcaa ggaaggctca cccccacaac cccgggctgc ctaacatatc catcctgtcg       240
     acgggcggca ccatcgccag ccgggtagat tatcgtaccg gcgcggtgtc gagccagttc       300
     accgccgacg acatcctgga cgccataccc gagctggggg acatggcgaa cttcaacggc       360
     cgggtgctga gcatgatctt cagcgaggac atggacgcct ccgtgtggca gaacctcgcc       420
     agggcctgcc acgaggaaat taagaacggc gccgacggca tcatcgtcac tcacgggacg       480
     gacacgctga gctacacggc cgcggccctc tccttcatgg tccggtcgcc cgtgccgatc       540
     gtgctcgttg gggcgcaaag gtcctcggac cggccctcga gcgataacgc catgaacatg       600
     atctgcgcca cggccgtatc aacgtcagac atcgccggcg tcacggtggt catgcacggc       660
     gagacgtcgg acgatttctg ttatgttcat cgtggcacca aggtccgtaa gcttcacacg       720
     tccatgagga ccgctttcca gagcgtgaat gtgcccccca tcgcccgagt ggactatgcc       780
     accaggaaga tcactcccat cacgggatac gtaaagcggg gcgagcagga gcttaaatta       840
     atgggcgata tggagacgaa gtgcgccctc gtcaagttct acccgggcat gtcccccgag       900
     atcatcgact attaccggga gaaaagcttc aaagggctgg tgctggaggg caccgggctg       960
     ggccacgtga gcacgaagtg gctgcccgcg atagagaagg ccgtatcggc cggcataacg      1020
     atagtgatga cctcccagtg catcaacggc cgcatatgcg accgcgtata ctccacgggc      1080
     atcgacctgc tgaaagctgg agccatagag ggcgaggaca tgctgcccga agtggccctc      1140
     gtgaagctca tgtgggccct ggggcagacg aacgatatgg cccaggtaaa gaggatcatg      1200
     caacatgact acgcgggcga gatacactgg aggtcgaccg tatga                      1245
//

If you have problems or comments...

PBIL Back to PBIL home page