(data stored in ACNUC10043 zone)

EMBL: AP011532.GYRA

AP011532.GYRA        Location/Qualifiers
FT   CDS_pept        complement(686233..688671)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="gyrA"
FT                   /locus_tag="MCP_0711"
FT                   /product="DNA gyrase subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0711"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60783"
FT                   /db_xref="GOA:D1YWG1"
FT                   /db_xref="InterPro:IPR002205"
FT                   /db_xref="InterPro:IPR005743"
FT                   /db_xref="InterPro:IPR006691"
FT                   /db_xref="InterPro:IPR013757"
FT                   /db_xref="InterPro:IPR013758"
FT                   /db_xref="InterPro:IPR013760"
FT                   /db_xref="InterPro:IPR035516"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWG1"
FT                   /protein_id="BAI60783.1"
FT                   /translation="MATQETVLPVKIEEEMRKSYIDYAMSVIVGRALPDVRDGLKPVHR
FT                   RVLYGMYELGNTYDKPYKKSARVVGDVMGKYHPHGDMAIYDTIVRMVQDFSLRYPLIDG
FT                   QGNFGSVDGDSAAAMRYTEVRMAKIADEMLDDLDKETVNFVPNFDESLKEPSVLPAKLP
FT                   NLLINGSSGIAVGMATNIPPHNISEVIDGTVALINDPAIEPLELLKLITGPDFPTGAYI
FT                   YGREGIKDAYLTGRGSIKIRAKAEITEEGGRNVILVTEIPYMVNKAKLIENIADLVRDK
FT                   KLEGISDLRDESDRDGMRIVIELKKGANANVLLNQLYRHTQMETTFGVNNLALVDNQPR
FT                   TLSLKETLEYYLKHRQEVVTRRSQFELKKAQAREHILAGLLVALDNIDDFVNILRRSAS
FT                   ADDAKAVFMSKYGLSEEQSKAILDMRLRGLTGLERRKIEDERAELIKLIAHLKEVLASP
FT                   QMVLDIIKNELLELRAKYGDGRRTIIKESDGEIVDEDLIPVENVVVTISNTGYIKRQPV
FT                   DTYRTQRRGGMGIMGMETKEEDFVVDVFTASTHDHLLFFTNKGRVYVLKVYEIPEASRQ
FT                   SRGKAIVNLLTLMPNESVNAMIPIKEFDEKHYLIMCTREGTIKKTALSSFQNIRRTGII
FT                   AIGLDEGDELISVKLTNGGQEVLIATRNGKANRFSESEVRPMGRQAGGVIGIRLTEKDK
FT                   VIGMEVVSESASILTVCENGFGKRTAISEYTPHHRGGQGMINIKTTLRNGGVVAIASVT
FT                   DDDQLLVVTRDGIMMRINVKDISEISRNTQGVKIITLKSENDAVVGVAKLVSEKKEEEI
FT                   "
     atggcaacac aggagacagt tttaccggtc aagatagaag aggagatgcg taagtcctac        60
     atcgattacg cgatgagcgt tatcgtgggg cgtgcgttgc cggacgtacg tgacgggctg       120
     aagcctgttc accgccgtgt tttgtacggc atgtacgagc tgggcaacac ttacgataag       180
     ccttataaga agtcggccag ggtggtcgga gacgtcatgg gtaagtacca cccgcacggc       240
     gacatggcca tctacgatac catcgtcagg atggtccagg acttctcatt gcgttacccg       300
     ctcatcgatg gccagggcaa cttcggcagc gtggacggcg atagcgccgc agccatgcgt       360
     tacaccgagg tccgcatggc gaagatcgcg gacgagatgc tcgacgacct ggacaaggag       420
     accgtcaact tcgtgcccaa tttcgatgaa tcgctgaagg agccttccgt gctaccggca       480
     aagctcccga acctgctcat taacggctca tcgggcatcg cagtgggcat ggcgaccaac       540
     atcccgccgc acaacatttc cgaggtcatc gacggcacgg tcgcgttgat caacgacccg       600
     gcgatcgagc ctcttgagct attgaaactc atcaccggcc ccgatttccc caccggcgct       660
     tacatctacg gccgggaagg cattaaggac gcatatctca ctggcagggg ctccataaag       720
     atcagggcca aagccgagat cacggaggaa ggcggcagga acgtcatcct tgtcaccgag       780
     atcccgtaca tggtcaacaa ggcaaagctc atcgagaaca tcgccgacct ggtgagggat       840
     aagaagctcg agggcatatc agacctgaga gacgagtccg accgggacgg catgcggatc       900
     gtcatcgagc tcaagaaggg cgccaacgcc aacgtgctgc tgaaccagct ttacaggcac       960
     acccagatgg agacgacctt cggcgtcaac aacctggcgc tggtggacaa ccagcccagg      1020
     acgctgagcc tgaaggagac gctggagtac tacctcaagc acaggcagga agtcgtaacc      1080
     cgcagaagcc agttcgagct gaagaaggcc caggccaggg aacacatact ggcaggcctg      1140
     ctggtggccc tggacaacat cgacgacttc gtcaatatcc tgaggaggtc cgccagcgcg      1200
     gacgacgcga aggccgtgtt catgtcgaag tacggcctct ccgaagagca gtcgaaggcc      1260
     atccttgaca tgcggctcag gggcctcacg ggcctggagc gcaggaagat cgaggacgag      1320
     cgcgccgaat taataaagct gatcgcgcac ctgaaggagg tgctggccag cccgcagatg      1380
     gtgctggaca tcataaagaa cgagcttctc gagctcaggg caaagtatgg cgacgggcgg      1440
     aggaccatca tcaaggagtc cgacggcgag atcgtcgacg aggacctcat tcccgtagag      1500
     aatgtcgtcg tcacgatctc taacacgggc tacataaaga ggcagcccgt ggacacgtac      1560
     cggacccagc gcaggggcgg catgggcatc atgggcatgg agaccaagga agaggacttc      1620
     gtcgtcgatg tcttcacggc ctccacgcac gaccacctgc tcttcttcac caacaagggc      1680
     agagtatacg tgttgaaggt ctacgagata cccgaggcca gccggcagtc caggggcaag      1740
     gcgatcgtga atttgctcac gctgatgccg aacgagtcgg tcaacgccat gatccccatc      1800
     aaggagttcg acgagaagca ctacctgatc atgtgtaccc gcgagggcac gatcaagaag      1860
     acggcgctct cgtctttcca gaacatccgc aggacgggca tcatcgccat cgggctggac      1920
     gagggcgacg agctcatatc ggtcaagctc acgaacggtg gccaggaagt gctgatcgcg      1980
     acgaggaacg gcaaggcgaa ccgcttcagc gaatcggaag tccggcccat gggccgccag      2040
     gcgggcggcg tcataggcat ccggctcacc gagaaggaca aggtcatcgg catggaagtc      2100
     gtcagcgaga gcgcgtccat cctgacggtc tgcgagaacg gcttcggcaa gcggaccgcg      2160
     atctcggagt ataccccgca ccaccggggc ggccagggca tgatcaacat caagaccacc      2220
     ctccggaacg gcggcgtcgt ggcgatcgcc tcggtcaccg acgacgacca gctgctcgtg      2280
     gtcacccggg acggcatcat gatgcgcatc aacgtgaagg acatctcgga gatcagccgc      2340
     aacacccagg gcgtcaagat catcacgctc aagtcggaga acgacgccgt ggtgggcgtc      2400
     gccaagctgg tgtccgagaa gaaggaagaa gagatctaa                             2439
//

If you have problems or comments...

PBIL Back to PBIL home page