(data stored in ACNUC10043 zone)

EMBL: AP011532.HDRD-1

AP011532.HDRD-1      Location/Qualifiers
FT   CDS_pept        286264..287307
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hdrD-1"
FT                   /locus_tag="MCP_0282"
FT                   /product="putative CoB--CoM heterodisulfide reductase
FT                   iron-sulfur subunit D"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0282"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60354"
FT                   /db_xref="GOA:D1YV82"
FT                   /db_xref="InterPro:IPR004017"
FT                   /db_xref="InterPro:IPR009051"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YV82"
FT                   /protein_id="BAI60354.1"
FT                   /translation="MIQDHIEDIIKCTRCGRCRALCPINEELGWESTNARGRMLLARAL
FT                   AEGEKPSYAMKRSFYTCLTCSMCTSTCPSGAKPDDVVEDARREMIAQGSAPPYYDTILE
FT                   NITKHGNSLGDTGPRNAWVPEELRLNNGSADVIYWSGCLTSYRQQQTALSNLKILSRFG
FT                   ARVLDDERCCGSPLLRLGGDSVALEHNRKEIEKSGAKTLVTGCAGCYKTLSESLDIEVL
FT                   HVTQFLARHVDELPLERLPYRVSYHDPCHLGRCMKVYDEPRTIIKRICEFEEMATSRSL
FT                   AKCCGGGGGVRRGYGDLARKVAKKRLMDAPAGIDYIITACPMCHANLQDAGGKVLDISE
FT                   LVLMSMI"
     atgatccagg accatatcga ggatatcatc aagtgcacca ggtgcgggcg ctgcagggcg        60
     ctctgcccta tcaacgagga gctcggctgg gagtcgacga acgcccgggg ccggatgctt       120
     ctcgcgaggg cgctggcaga gggcgagaag ccctcctacg ccatgaagag gtcgttctat       180
     acctgcctga cgtgctccat gtgcacctcg acctgcccct ccggcgcgaa gccggacgac       240
     gtcgttgagg atgcccggcg ggagatgatc gcgcagggca gcgctccgcc ttattacgat       300
     actattctcg agaacatcac gaagcacggc aactccctgg gcgataccgg cccccggaac       360
     gcctgggtgc ccgaggagct gaggcttaac aatggcagtg cggacgtcat ctactggtcc       420
     ggctgtttaa cttcgtacag gcagcagcag accgcgctgt cgaaccttaa gatattgagc       480
     cgtttcggcg cgagggtgct cgatgacgag aggtgctgtg gctccccgct attgcgcctg       540
     ggcggcgatt cggtcgcgct cgagcacaac aggaaagaga tcgagaaaag cggcgcgaag       600
     accctggtga ccgggtgcgc ggggtgctac aagaccctga gcgagagcct ggacatcgaa       660
     gtgctccacg tgacgcagtt cctcgcaagg cacgtcgacg agctccccct cgagaggctc       720
     ccgtaccggg tgagctacca cgacccgtgt caccttggcc ggtgcatgaa agtttatgac       780
     gagccccgca ccataataaa gcggatctgc gagttcgagg agatggccac cagcaggagc       840
     ctggcgaaat gctgcggcgg cggaggcggg gtccgtagag gatacggcga cctcgcaagg       900
     aaagtggcta aaaagcgcct catggacgcg ccggcgggca tcgactatat cataacagca       960
     tgccccatgt gccacgccaa cttacaggac gccgggggca aggtgctcga catatccgag      1020
     ctcgtgctca tgtcgatgat atag                                             1044
//

If you have problems or comments...

PBIL Back to PBIL home page