(data stored in ACNUC10043 zone)

EMBL: AP011532.HYPD

AP011532.HYPD        Location/Qualifiers
FT   CDS_pept        187321..188376
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="hypD"
FT                   /locus_tag="MCP_0194"
FT                   /product="hydrogenase expression/formation protein HypD"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0194"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60266"
FT                   /db_xref="GOA:D1YUZ4"
FT                   /db_xref="InterPro:IPR002780"
FT                   /db_xref="InterPro:IPR042243"
FT                   /db_xref="InterPro:IPR042244"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUZ4"
FT                   /protein_id="BAI60266.1"
FT                   /translation="MQEEQIAKGLAKKIEKLAAGREIKIMHVCGTHEYTITKSGIRSLL
FT                   PKNVKVVMGPGCPVCVTPQAEIDAIVELAEQGKVICTYGDLLRVPGSRTSLYDSVGEIH
FT                   IVQSISQAVDFAREHPDKEVVFMAVGFETTAPTTAAVMLANPPDNFSILVSHRLVPPAM
FT                   KWLMQQGEANLSGFLLPGHVCAISGIEEYEQFPVPQVIAGFEPLQVMYGLYKLVRQIVE
FT                   NRAEVENAYMSVVKREGNVKAKHMMAEVFDVCDIMWRGFPVIPDSGLRLKPQFEKYDAL
FT                   KKYGITLKPGMETKGCLCNQLLRGIKEPTDCKLFGRACTPLKPVGACMVSTEGACRIWY
FT                   TYGRGAKLVKD"
     atgcaagagg aacagatcgc gaaggggctc gccaagaaga tagagaagct ggcggcgggc        60
     cgtgagatta agatcatgca cgtgtgcggg acgcacgagt acacgataac gaagagcggc       120
     atccggtcgc tcctcccgaa gaacgtgaag gtggtcatgg gcccgggctg cccggtgtgc       180
     gtcacccccc aggccgagat cgacgccatt gtggaactgg cggagcaggg caaggtcatc       240
     tgcacctacg gcgacctcct tagagtgccc ggctcaagga cgtcgctgta cgactcggtg       300
     ggcgagatcc acatcgtcca gagcatcagc caggccgtcg acttcgcccg ggagcacccg       360
     gacaaggagg tcgtgttcat ggcagtgggc ttcgagacca ccgcccccac gacggctgcc       420
     gtcatgctcg ccaatccccc ggataacttt tccatcctcg tctctcaccg cctggtgccg       480
     ccggccatga agtggctcat gcagcagggc gaggccaacc tttccggctt tttattgccg       540
     ggccacgtct gcgccatcag cggcatcgag gagtacgagc aattccccgt accgcaggtc       600
     atcgcgggct tcgagcccct gcaggtcatg tatggcctgt acaagctggt caggcagatc       660
     gtagaaaacc gggccgaggt ggagaacgcc tacatgagcg tggtgaagcg ggagggcaac       720
     gtcaaggcga agcacatgat ggccgaagtc ttcgacgtct gcgacatcat gtggcgaggc       780
     ttcccggtca ttcccgacag cggcttaagg ctgaaacccc agttcgagaa gtacgacgcc       840
     cttaaaaagt acggcatcac gctcaagccg ggcatggaaa caaagggctg cctgtgcaac       900
     caattattaa gagggatcaa ggagcccacc gactgtaagc tctttggcag ggcgtgcacg       960
     cccctgaagc ccgtcggcgc ctgcatggtg tccaccgagg gcgcctgccg catctggtac      1020
     acgtacgggc ggggcgcgaa gctggtaaaa gactga                                1056
//

If you have problems or comments...

PBIL Back to PBIL home page