(data stored in ACNUC10043 zone)

EMBL: AP011532.MCRG

AP011532.MCRG        Location/Qualifiers
FT   CDS_pept        506855..507613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mcrG"
FT                   /locus_tag="MCP_0515"
FT                   /product="methyl-coenzyme M reductase gamma subunit"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0515"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60587"
FT                   /db_xref="GOA:D1YVW5"
FT                   /db_xref="InterPro:IPR003178"
FT                   /db_xref="InterPro:IPR009024"
FT                   /db_xref="InterPro:IPR036994"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVW5"
FT                   /protein_id="BAI60587.1"
FT                   /translation="MAYKAQYYPGKTSVAQNRKKFMDPSYKLEKIRSLSDDDVVIMLGH
FT                   RAPGSAYKTIHPPLKEGGEPDDPIRKIVEPTAGAAAGDRIRYCQFTDSMFYAPAVPYLR
FT                   SWMAATRYRGVDPGTLSGRQIVEARERDVEKITKELMETEVYDAARSGLRGCTVHGHSL
FT                   RLNENGMMFDMLQRVVLDKNGNVYAVKDQVGDPLDRKVNLGKPMSDAELKKRTTIYFIG
FT                   GVPFRSDAEVVGWVQRIHNERTKCGFAPKL"
     atggcataca aagcacaata ttaccccggt aaaacttctg tggcccagaa cagaaagaag        60
     ttcatggacc catcttacaa gctggagaag atcaggagcc tctccgacga cgacgtagtc       120
     atcatgctcg ggcaccgcgc cccgggatcg gcctacaaga ccatccaccc gccactcaag       180
     gaaggcggcg agccggatga cccgatcagg aagatcgtag agcccaccgc cggcgcagca       240
     gccggtgaca ggatcaggta ctgccagttc actgactcca tgttctacgc gcccgccgtg       300
     ccctacctca ggtcatggat ggccgcgacc aggtacaggg gagtagaccc cggtacgctg       360
     tccggccgtc agatcgtaga ggcccgtgag agggatgtgg agaagatcac caaggaactc       420
     atggagacag aggtctacga tgcagcgaga agcggcttaa gaggctgcac cgtgcacggc       480
     cactccctca ggctgaacga gaacggcatg atgttcgaca tgctgcagag ggtcgtcctg       540
     gacaagaacg gcaacgtcta cgccgtcaag gaccaggtcg gcgacccgct ggaccgcaag       600
     gtcaacctcg gcaagccaat gtccgatgcg gaactcaaga agaggaccac catctacttc       660
     atcggcggcg tacccttcag gtccgacgct gaggtcgtag gctgggtcca gaggatccac       720
     aacgagagga ccaagtgcgg cttcgcgccg aagttgtaa                              759
//

If you have problems or comments...

PBIL Back to PBIL home page