(data stored in ACNUC10043 zone)

EMBL: AP011532.MOAA

AP011532.MOAA        Location/Qualifiers
FT   CDS_pept        635406..636344
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaA"
FT                   /locus_tag="MCP_0653"
FT                   /product="probable molybdenum cofactor biosynthesis protein
FT                   A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0653"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60725"
FT                   /db_xref="GOA:D1YWA3"
FT                   /db_xref="InterPro:IPR000385"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR010505"
FT                   /db_xref="InterPro:IPR013485"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWA3"
FT                   /protein_id="BAI60725.1"
FT                   /translation="MQESLVDNYGRRVTSLRMSLTNRCNLQCIYCHNEGESGSGGEITV
FT                   DEIARLVRIATKYGVDRVKFSGGEPLLRTDLEDILRALPPLKDISLTTNGTLLAPRAKG
FT                   LKEAGLDRVNISLDTMDSGRFDLITQRKGQFSRVMDGINAAIDAGLTPVKLNMVYLKGI
FT                   NEDEIERMIEFIRGRPLVLQVIELMNFKGAFKYHADISALEHSLKARADDYKCREMHRR
FT                   TKYYLNGAEVEIVRPIDNSEFCMNCNRLRVTSDFKLKPCLLRNDNLVSLRGLDDEGLEK
FT                   ALRYTVGIREPFFKAAPVAMPKKSEKVPSEN"
     atgcaagaaa gcctggtgga caattacggc agaagggtga cgagcctcag gatgtcgctc        60
     accaacaggt gcaaccttca gtgcatctac tgccacaacg agggcgagtc gggctcgggc       120
     ggggagatca ccgtggacga gatcgcccgc ctggtgcgca tagccacgaa gtacggcgtc       180
     gaccgggtaa agttctccgg cggagagccg ctccttagaa cggacctcga ggacatcctg       240
     agggcgctgc cgccgctgaa ggacatttcg cttacgacga acggcacgct tctggccccg       300
     cgggctaagg gcctcaagga ggccgggctc gaccgggtca acatcagcct cgatacgatg       360
     gacagcggcc gtttcgacct catcacccag cgtaaaggcc agttcagcag ggtcatggac       420
     ggcatcaacg ccgccatcga tgccgggctg acgcccgtga agctcaacat ggtctacctg       480
     aaaggcatta acgaggacga gatcgagcgc atgatcgagt tcatccgcgg caggcctctc       540
     gttcttcagg tcatcgagct catgaatttc aagggcgcct tcaagtatca tgcggacatc       600
     tccgctctgg agcattctct aaaggccagg gcggacgact ataaatgcag ggagatgcac       660
     cgccgcacca agtattacct gaacggcgcc gaagtggaga tcgtgcgccc catcgataat       720
     tccgagttct gcatgaactg taaccggctc cgtgtcactt ccgacttcaa gcttaagccc       780
     tgtctgcttc gcaacgataa tctcgttagt ctgcgggggc ttgacgatga gggcctcgaa       840
     aaggcactgc ggtatactgt gggcatccgg gagccgttct tcaaggctgc gcccgtcgcc       900
     atgcctaaaa aatccgaaaa agtcccctcg gaaaattga                              939
//

If you have problems or comments...

PBIL Back to PBIL home page