(data stored in ACNUC10043 zone)

EMBL: AP011532.MOAC

AP011532.MOAC        Location/Qualifiers
FT   CDS_pept        701201..701677
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="moaC"
FT                   /locus_tag="MCP_0729"
FT                   /product="probable molybdenum cofactor biosynthesis protein
FT                   C"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0729"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60801"
FT                   /db_xref="GOA:D1YWH9"
FT                   /db_xref="InterPro:IPR002820"
FT                   /db_xref="InterPro:IPR023045"
FT                   /db_xref="InterPro:IPR023047"
FT                   /db_xref="InterPro:IPR036522"
FT                   /db_xref="UniProtKB/TrEMBL:D1YWH9"
FT                   /protein_id="BAI60801.1"
FT                   /translation="MRSTDFTHVEGDKVKMVDVGSKEEVVRIARASGTIHLTKETMALI
FT                   KAGNVKKGNVLAAARIAAIQAAKHTWETIPLCHQIPITGIDVEFEVGDTDIKAIAEVRS
FT                   VGKTGVEMEALCAVSTALLTIWDMVKAVEKDETGNYPETKITNIVVDKKIKAKQ"
     atgcgttcca ccgattttac tcacgtcgag ggcgacaagg tcaagatggt cgacgtggga        60
     tccaaggagg aggtcgtccg catcgcccgg gcgagcggca ccattcacct tacgaaggag       120
     acgatggccc tcatcaaggc gggcaacgtg aagaagggca acgtcctggc tgcggcccgc       180
     atcgcggcca tccaggcggc aaagcacaca tgggagacca ttcccctctg ccaccagata       240
     cccatcacgg gcatcgacgt cgagttcgag gtcggagata cggatatcaa ggccattgcc       300
     gaagtccgct ccgtgggcaa gacgggcgtc gaaatggaag ccctgtgcgc cgtcagcacc       360
     gcgctgctga ccatctggga catggtgaag gctgtcgaga aagacgagac cggcaactat       420
     cctgaaacga agatcactaa tatcgtcgtc gataaaaaga tcaaggctaa gcaatga          477
//

If you have problems or comments...

PBIL Back to PBIL home page