(data stored in ACNUC10043 zone)

EMBL: AP011532.MTRA-1

AP011532.MTRA-1      Location/Qualifiers
FT   CDS_pept        528205..528954
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrA-1"
FT                   /locus_tag="MCP_0543"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit A"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0543"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60615"
FT                   /db_xref="GOA:D1YVZ3"
FT                   /db_xref="InterPro:IPR005778"
FT                   /db_xref="InterPro:IPR030688"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ3"
FT                   /protein_id="BAI60615.1"
FT                   /translation="MVDKKEPAKGWPVVKGEYDTGDAKSPVAVATCGSHFNLFPIKAGA
FT                   AISGPFKTENLGIEKIVANVISNPNIRFLVICGSEVKGHISGDALICLYKYGLKDGRIV
FT                   NAKGAIPFIENLDANAVKRFQEQVQIFEMVDVEDEAKITQVIKDCLAKDPGAFAGEPML
FT                   ITIKEKEEEVEVGAAIKPVSGELAIIQSRLRAIKDDVKDIGYLNKFTMGWYAGKMEGIA
FT                   IGVVLCVVLLALLFPGGIDWTKLLLKP"
     atggtagaca agaaagaacc agcaaaggga tggccagtcg tcaagggtga atatgatact        60
     ggagacgcaa agagccccgt cgcggtcgcg acctgcggct cgcacttcaa cctgttcccc       120
     ataaaggccg gcgcggccat atccggaccc ttcaagaccg agaacctcgg catcgagaag       180
     atcgtcgcga acgtcatatc caacccgaac atccggttcc tggtgatctg cggttctgaa       240
     gtcaagggcc acatatcggg cgacgccctg atatgcctgt acaagtacgg cctgaaggac       300
     ggaaggatcg tcaatgcaaa gggcgctatc cccttcatcg agaacctcga cgccaacgcc       360
     gtcaagaggt tccaggaaca ggtacagatc ttcgagatgg tggacgtaga ggacgaggcc       420
     aagatcactc aggtcatcaa ggactgtctc gcaaaggacc ccggcgcgtt cgcaggggag       480
     ccgatgctga tcaccatcaa ggagaaggaa gaggaagtcg aagtcggagc ggccataaag       540
     ccggtctctg gagagctcgc catcatccag tccaggctca gggcgatcaa ggacgatgtc       600
     aaggacatcg gctacctgaa caagttcacc atgggctggt atgcgggcaa gatggaaggc       660
     atcgccatag gcgtcgtctt atgcgtggtg cttctagcct tactgttccc cggcggcatc       720
     gactggacta aattattatt gaaaccgtag                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page