(data stored in ACNUC10043 zone)

EMBL: AP011532.MTRC

AP011532.MTRC        Location/Qualifiers
FT   CDS_pept        527076..527888
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrC"
FT                   /locus_tag="MCP_0541"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit C"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0541"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60613"
FT                   /db_xref="GOA:D1YVZ1"
FT                   /db_xref="InterPro:IPR005865"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ1"
FT                   /protein_id="BAI60613.1"
FT                   /translation="MSEVKELDWYMLAALGIVGGLIAIYLAYFLNTYMKVGYFSFLGAV
FT                   GAILAIVWGADAVRRICKYGIGTGVPSIGMLAFGMGLLATLLGLKIGDYVGIVYVGPIA
FT                   AIVLSLVQGAIIGFIANSVLKMKIPTMQIGMVFIAGAASIILMGFTTTIAGSFDYASMM
FT                   KYVFETGFIAPLFMIGALPMLHPFNACLGPDEDQRRTLTLAVEAGLLSTIMFGLMSLYT
FT                   FQANILPALITVVLGLLGWIYAYLAYFNKVKESGVTVLATGVLPKKEA"
     atgtccgaag tcaaagaact cgactggtat atgctcgctg cccttggtat cgtgggcggc        60
     cttatcgcca tatacctggc atatttcctg aatacttaca tgaaagtcgg atacttctcc       120
     ttcctcggcg ctgtcggcgc catactagca atagtatggg gcgcggacgc ggtcaggagg       180
     atctgtaagt acggtatcgg tacgggcgtt ccgtccatcg gcatgctcgc gttcggcatg       240
     ggcctgctgg ccacgctgct cggcctcaag ataggcgact acgtgggcat cgtatacgtc       300
     ggccccatcg cagccatcgt gctgtcgctc gttcagggcg ccatcatcgg tttcatcgcg       360
     aactccgtcc ttaagatgaa gatcccgacc atgcagatcg gcatggtctt tatcgccggc       420
     gcggcgagca tcatcctgat gggcttcacg accacgatcg cgggctcgtt cgactacgcg       480
     tcgatgatga agtacgtctt cgagaccggc ttcatcgcac cgctgttcat gatcggagct       540
     ctcccgatgc tgcacccgtt caatgcctgc ctcggccccg atgaggacca gagaaggacc       600
     ctcacgctgg ccgtagaagc gggcctgctg tcgaccataa tgttcggctt aatgtcgctc       660
     tacacgttcc aggcgaacat actcccggcc ttaataaccg tagtgctggg cctgctcggc       720
     tggatatacg cgtacctggc ctacttcaac aaggtcaagg aaagcggcgt gacggtgctc       780
     gccacaggcg tactgcccaa gaaggaggca taa                                    813
//

If you have problems or comments...

PBIL Back to PBIL home page