(data stored in ACNUC10043 zone)

EMBL: AP011532.MTRH

AP011532.MTRH        Location/Qualifiers
FT   CDS_pept        529405..530355
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="mtrH"
FT                   /locus_tag="MCP_0546"
FT                   /product="tetrahydromethanopterin S-methyltransferase
FT                   subunit H"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0546"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60618"
FT                   /db_xref="GOA:D1YVZ6"
FT                   /db_xref="InterPro:IPR011005"
FT                   /db_xref="InterPro:IPR023467"
FT                   /db_xref="UniProtKB/TrEMBL:D1YVZ6"
FT                   /protein_id="BAI60618.1"
FT                   /translation="MFKYDTPQKVYEVGRAKVGGNPGEYPTVLAGSIFYNKEPIFASKE
FT                   DSAKGIFNKEGAEKLIRQQEEMSDITGNKVWVQIVSETEESMIKYIEWYSNVGKDAFLV
FT                   DSTVASARIAGAKKADEIGISDRVIYNSINAAAQQAEMDAIKPLKFTSAIILGFNAVDM
FT                   SVKGRMEMFTKGGAGQAKGMLTLGTEKGITRPLLDVAATPLGSGSGATYRSIFAVKSQL
FT                   GEPVGGGYHNIPSAWAWLKKFKKQPGKEGAYMPSDIGSNLVAITLGCNFCLYGPIEHSV
FT                   EVFPAVAMNDIIVAEAAKDLGTAPLSEVNPLTKLA"
     atgtttaagt atgatacacc acaaaaggtc tatgaggtcg gcagggcaaa agtcggtgga        60
     aaccctggcg aatacccgac cgttttagcg ggttccatat tctacaacaa ggagcccatc       120
     ttcgcaagca aggaggacag cgcgaagggc atcttcaaca aggaaggtgc ggaaaagctc       180
     atcaggcagc aggaggagat gtcggacatc accggcaaca aggtctgggt acagatcgtc       240
     tccgagactg aagagtccat gatcaagtac atcgagtggt actcgaacgt cggcaaggac       300
     gcgttcctgg tcgactcgac cgtggcatcc gccaggatcg ccggcgcaaa gaaggccgac       360
     gagatcggca tatccgacag ggtcatctac aactccatca acgccgccgc acagcaggcc       420
     gagatggacg cgatcaagcc cctaaagttc acctccgcca tcatcctcgg cttcaacgcc       480
     gtcgatatgt ccgtcaaggg caggatggag atgttcacca agggcggcgc aggccaggca       540
     aagggcatgc tcaccctcgg taccgagaag ggcatcacca ggccgttact cgatgtagcg       600
     gcaaccccgt tgggcagcgg ttccggtgcg acctacaggt ccatcttcgc cgtgaagtcc       660
     cagctcggag agcccgtagg cggcggctac cacaacatcc cgtccgcatg ggcgtggctg       720
     aagaagttca agaagcagcc gggcaaggaa ggcgcgtaca tgccgtcgga catcggcagc       780
     aacctcgtcg ccatcaccct gggctgcaac ttctgtctct acggccccat cgagcactcc       840
     gtcgaggtct tccccgcggt cgccatgaac gacatcatcg tcgccgaggc cgcaaaggac       900
     ctgggcaccg ctccgctgtc ggaagtcaac ccgctgacca agctggcata a                951
//

If you have problems or comments...

PBIL Back to PBIL home page