(data stored in ACNUC10043 zone)

EMBL: AP011532.PE116

AP011532.PE116       Location/Qualifiers
FT   CDS_pept        complement(104307..105953)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0116"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0116"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60188"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUR6"
FT                   /protein_id="BAI60188.1"
FT                   /translation="MPFHAREEAYGPPRAELYTREDIEEVFQCVSALCTCDRLSSPAKS
FT                   DPLFRPPFPAARARAFREGKEKSLISFHLRPDLRALYPVSTLAYYLSAPIVEDEDNYIA
FT                   FSPGETTDIPGAPELETWAGEALRRTFYLDCAVRYAAVSGGRLNGLDVEKLLRGRAEDI
FT                   FEMGPGERLMLYSGVRVVPGMPSWHMAAYLDPVPGSVEALPFLMRSLAAIYMPRAFPVN
FT                   ERAVVSMSVHEFLGKQKGPDTACPGGHVVLPSLREAGIQLWFSDGFPVDASKVSLRSIS
FT                   GKRRERKNKGTSIGIVCNEESMSGEVDAIIDALGDTEASVEILWDASVDKYAGAFARGF
FT                   DVLQVIGHCDERGLKCHDGFASVKDIEKNRTPMFFFNSCASYREAAQLVEWGSVCGVAT
FT                   LFRVLEEAAVDLCRDFYRMLGAGYTASVSLNAARECSALGKEYLLLGNGSFTCFEGDPL
FT                   KPFYRINSRPGGFSLGCTTGNVDKGYVVSSWSPGGRTMISDLGFETGPMKAEQLIAISE
FT                   KFQGYCIYGRRLYESVGDAALKALEDWRCRT"
     atgccgtttc atgcccgtga ggaggcatac ggcccgcctc gcgcagaatt gtatacgcgg        60
     gaagatatag aggaggtatt tcaatgcgtt tctgccctat gtacgtgtga ccggctaagc       120
     agcccggcga agagcgatcc gctattcagg ccgccctttc cggccgcaag ggcccgagcg       180
     ttccgggagg ggaaagaaaa aagccttata tcctttcatt tgcgtccgga tctcagggcg       240
     ctctatcccg tatccactct tgcgtattat ttaagcgcgc cgatcgtgga ggatgaggat       300
     aattatatcg cttttagccc gggagagacg accgacatac ccggcgcccc tgagctcgag       360
     acgtgggcgg gcgaggcgct gaggaggaca ttttacctgg actgcgcggt aaggtacgcc       420
     gcagtatccg ggggaaggct gaacggcctg gacgtggaaa agctgctccg cgggcgcgcg       480
     gaggacatct tcgagatggg gccgggagag cgccttatgt tatattcggg cgtgcgtgta       540
     gtgccaggca tgccgtcgtg gcatatggcc gcatacctgg acccggtccc ggggagcgtg       600
     gaggcgctgc cttttctgat gcgttccctc gccgcgatat atatgccgcg ggcgttccct       660
     gttaacgaga gagcggtcgt atcgatgtcg gtccatgagt tcctgggaaa gcagaaaggg       720
     cccgatactg catgccccgg aggtcatgtc gtcctgccgt cgctgcgtga ggccggcatc       780
     cagctctggt tctcggacgg gttcccggtg gatgcgtcaa aagtgagcct gcgttcgata       840
     tccgggaaga ggcgtgaaag aaaaaacaag ggcacgtcga tcggcatcgt atgtaatgag       900
     gagtccatgt cgggcgaggt cgatgccatt atcgacgctc ttggggatac tgaggcttcc       960
     gttgagattc tctgggatgc cagcgtcgat aagtatgccg gggccttcgc ccgcggcttc      1020
     gacgtactac aggtcatcgg ccattgcgat gagagagggc tcaaatgcca tgacgggttc      1080
     gcgagcgtaa aggacataga aaagaacagg acgcccatgt ttttcttcaa ttcctgtgcg      1140
     agctaccgtg aggcggcgca gctggtcgag tggggctccg tctgcggtgt ggccacgctt      1200
     ttcagggtgc ttgaggaggc cgcggttgac ctgtgcaggg atttttaccg gatgctcggc      1260
     gccggctata ctgcctccgt atctctcaac gctgcccgcg agtgctccgc gctgggaaaa      1320
     gagtacctgc tcctggggaa cggctcgttc acatgtttcg agggggaccc cctaaagccg      1380
     ttctacagga taaactcccg tcctggaggg ttttcgctgg gatgtactac gggtaatgtc      1440
     gacaaagggt acgtggtgag ctcctggtct cccgggggca ggacgatgat ctccgacctg      1500
     ggcttcgaga ccgggccaat gaaggcggaa cagctcatcg cgatatcgga aaagttccag      1560
     ggctattgca tctacggccg caggctttac gagagcgtcg gggacgcggc ccttaaggcc      1620
     ctggaggact ggcgttgtcg tacatga                                          1647
//

If you have problems or comments...

PBIL Back to PBIL home page