(data stored in ACNUC10043 zone)

EMBL: AP011532.PE121

AP011532.PE121       Location/Qualifiers
FT   CDS_pept        117292..118470
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0121"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Radical SAM domain (IPR007197)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0121"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60193"
FT                   /db_xref="GOA:D1YUS1"
FT                   /db_xref="InterPro:IPR006638"
FT                   /db_xref="InterPro:IPR007197"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="InterPro:IPR040088"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS1"
FT                   /protein_id="BAI60193.1"
FT                   /translation="MLSMAVFSEVYDEDNDKVFVIRGTIEVRIPHNFYSQLKRKYSDEE
FT                   IVSMQEPKILRHHHTKRELVYVTKESGLPLIGHTAFGLIDRGTNLIQVRPVSGCNLNCI
FT                   FCSVDEGVSKSRRTDYIVDTDYLVEEFAKLAALKGDDVEAHIDGQGEPFIYPYMVELLE
FT                   KLRKVPHVKVISAQTNGMLLDPEKIRAMEGLLDRINLSISSMDPRRGRMLAGTNLYDVE
FT                   HVKEVARAVAASDIDLLLAPVWVPGFNDEDIPKLIEFGLEIGAGKRWPGFGIQNYVRYQ
FT                   FGKKVRGRPMKFSEFFKRLEEYGKQYGLNLKLTPADFGIHKAPGLPRAFRRGERVKLEL
FT                   VAPGRVFGEMLAVSRGRVIGVLTDRPAGSTVFAEITRTNDNVYVAVTAESRL"
     gtgttatcga tggcggtctt ttccgaggtg tacgacgagg ataacgacaa ggtgttcgtg        60
     atccggggga ccatcgaggt ccggatcccc cataattttt actcccagct taagcgcaag       120
     tattcggacg aggagatcgt gtccatgcag gagcccaaga tactccggca ccaccacacg       180
     aagcgggagc ttgtctacgt gacgaaggag tcggggctgc ccctcattgg ccacacggcc       240
     ttcggcctca tcgaccgcgg gacgaacttg atacaggtcc gcccggtgtc gggctgcaac       300
     ctgaactgta ttttctgcag cgtcgacgag ggggttagca agagccggcg gacggactac       360
     atcgtggaca cggactacct ggtggaggag ttcgcgaagc tggccgccct gaagggggac       420
     gatgtggagg cgcacatcga cggccaggga gagcctttta tttatcctta catggtggag       480
     ctgctggaga agctccgaaa ggtgccccat gttaaggtca tttcggccca gacgaacggc       540
     atgctcctcg acccggaaaa aataagggcg atggagggcc tgctggaccg catcaacctc       600
     tccatatcgt cgatggaccc ccgcaggggg cgtatgctgg ccggtaccaa cctgtacgac       660
     gtagagcacg tcaaggaagt cgccagggcc gtcgcagcaa gcgatattga cctgcttctg       720
     gcccccgtat gggtgcccgg gttcaacgac gaggacatcc cgaagctgat cgagttcggc       780
     ctggagatag gcgccggcaa gcgctggccc gggttcggca tccagaacta cgtccgttac       840
     cagttcggca agaaggtcag gggcaggccc atgaagttct ccgaattttt taagcggctc       900
     gaagagtacg ggaagcagta cggcttaaat ttgaaactca cgccggctga cttcggcata       960
     cataaggcgc cggggcttcc cagggcgttc cggagggggg agcgcgtgaa gctggagctc      1020
     gtggctcccg ggcgggtgtt cggcgagatg ctcgccgtga gcaggggccg ggtcatcggc      1080
     gtgctgacag acaggcccgc cgggtccacg gtgttcgccg agatcacccg gacgaacgac      1140
     aacgtgtacg tggccgtcac ggcagagtca aggctttga                             1179
//

If you have problems or comments...

PBIL Back to PBIL home page