(data stored in ACNUC10043 zone)

EMBL: AP011532.PE122

AP011532.PE122       Location/Qualifiers
FT   CDS_pept        complement(118448..119443)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0122"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Protein kinasedomain (IPR000719)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0122"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60194"
FT                   /db_xref="GOA:D1YUS2"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUS2"
FT                   /protein_id="BAI60194.1"
FT                   /translation="MGEYGRAPDVLERAGHAVLNNFFVEAALVFLISVLYISAQGADRL
FT                   LGTGFRRTLLDWMQAVSRDRLNFLRKAQIRHVFKKKYGMKKIKIRLAGGSYWLSIPCIV
FT                   KGVCKKTRSERKFLAKVMNERSALKHKYMTLFRNIGVIAEGVDLKFDDYHCGLEMGQYE
FT                   RLCLEKLRNASVNAPKVYGLHKMGGADYMLVMEYIDGKPLSKAEMSGEIMDQLFLILKK
FT                   MRENGILHGDVKLDNFMLSNGRVYVFDCLKIDRSGIEEAAAFDLACLLCALSGRLPPGE
FT                   VVKNARKFYSPSDLGRAAGMVDMALYKADLNLSDDRKKELKESLKALTLP"
     atgggcgagt acgggagggc gccggacgta ctcgaaaggg cgggacacgc cgtactgaat        60
     aactttttcg tggaggcggc gctcgtattc cttatcagcg tcctctatat ctccgcgcag       120
     ggcgccgacc gcctcttagg caccgggttt cgcaggaccc tgctcgactg gatgcaggcc       180
     gtctcccggg acaggctgaa cttcctgagg aaggcccaga taaggcacgt tttcaaaaag       240
     aagtacggga tgaagaagat caagataagg ctggcaggag gctcctactg gctctccatc       300
     ccctgcatcg tgaagggcgt ctgcaaaaaa acgcgctctg agaggaagtt cctggccaag       360
     gtcatgaacg agcggagcgc ccttaagcat aagtacatga cccttttcag gaacatcggc       420
     gtcatcgccg agggagtcga cctcaagttc gacgattacc actgcgggct ggagatgggc       480
     cagtacgagc ggctttgcct tgaaaaattg cgaaacgcct cggtgaacgc cccgaaagtt       540
     tacggcttac ataagatggg cggcgccgac tatatgctgg tcatggagta catcgacggg       600
     aagcccctct cgaaggccga aatgagcggc gagatcatgg accagctatt cttaatattg       660
     aaaaagatga gggagaacgg catcttacac ggcgacgtca agctggacaa cttcatgctc       720
     tcgaacggcc gggtctacgt gttcgactgc ctgaagatcg accgcagcgg catcgaagag       780
     gccgcggcct tcgacctggc gtgcctatta tgcgccctct cgggcaggct gccgccgggc       840
     gaagtcgtga aaaacgcccg gaagttctat tctccatcgg acctgggccg ggccgccgga       900
     atggtggaca tggcgctcta taaggccgac ctcaacctga gcgatgatcg gaaaaaagag       960
     ctcaaagaga gcctcaaagc cttgactctg ccgtga                                 996
//

If you have problems or comments...

PBIL Back to PBIL home page