(data stored in ACNUC10043 zone)

EMBL: AP011532.PE14

AP011532.PE14        Location/Qualifiers
FT   CDS_pept        complement(10049..10636)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0014"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0014"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60086"
FT                   /db_xref="InterPro:IPR014729"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG4"
FT                   /protein_id="BAI60086.1"
FT                   /translation="MKVRVLYSGGQDSSLSAVLLEPFFDVELVTCSFGSASWRHAGRAA
FT                   EAIGFPFRVLKLSPEVMEGCIDLMLKYGYPRYGINYVHLKALEAAAKGGGYVADGTRRD
FT                   DHSPALTMAEVKSLEMRLDVQYIRPLAGYGRHAIDALVKQHFEIVEGPAIEKSDYESEI
FT                   RSSIIEKYGKETVSRLFPQEHPQSRVMRRLQK"
     atgaaggtac gggttttata cagcggcggc caggacagct cgctgtccgc ggtcctgctc        60
     gagcctttct tcgatgtgga gctcgtgacg tgctcgttcg gctccgcctc gtggaggcac       120
     gccgggcggg ccgccgaggc catcggcttc ccattccggg ttttaaaact aagcccggag       180
     gtcatggagg gctgtatcga cctgatgctg aagtacggct acccgcgcta cggcattaac       240
     tacgtgcacc tgaaggcgct tgaggccgcg gcgaagggcg gcggctacgt ggcggacggc       300
     accaggcggg acgaccattc gccggcgctc acgatggccg aagtaaagag cctcgagatg       360
     cggctcgacg tgcaatacat ccggcccctg gccggctatg gcaggcacgc catcgacgcc       420
     ctcgtgaaac agcacttcga aatcgtcgag ggccccgcga tcgaaaagtc ggactacgag       480
     tccgagatac gatcatcaat cattgaaaaa tacgggaagg aaactgtaag caggctgttc       540
     ccgcaagagc acccccagtc gagggtgatg agaaggttac aaaaatga                    588
//

If you have problems or comments...

PBIL Back to PBIL home page