(data stored in ACNUC10043 zone)

EMBL: AP011532.PE147

AP011532.PE147       Location/Qualifiers
FT   CDS_pept        complement(144197..144865)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0147"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0147"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60219"
FT                   /db_xref="GOA:D1YUU7"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU7"
FT                   /protein_id="BAI60219.1"
FT                   /translation="MSLDWGVLAKEASRKSVHMAGFLIPVAYYFFLSRELLLILLGAGV
FT                   LGAGILELIRLSGVPLFPKVLLRDHEKKGLVGGYFYALTSSFLAVLLFDKPVAVAAMLF
FT                   LTLGDGITGLAGAALTMLAGPKEADKRKYDTDGRTLPEELWYALTHPKSPILMAVMLVV
FT                   CGAAGLALYPSLSFEMIAAGAFGAMAADAFPWRIFGLTVDDNLSIPLVSGCLMSLAAIV
FT                   "
     atgtcccttg attggggcgt gctggcgaag gaggcgtcga ggaagtccgt gcacatggcg        60
     ggcttcctga tccccgtcgc ctactatttt ttcctctccc gggaactttt gctgatcctg       120
     cttggcgcag gcgtgctggg cgccggcatt ctggagctta tccgcctgtc gggcgttcca       180
     ctctttccta aggtactgct ccgcgaccat gaaaaaaagg gcttagtcgg tgggtatttc       240
     tacgcgctga cctcgtcgtt cctggccgtg ctcctgttcg ataagccagt cgccgtcgcc       300
     gccatgctct ttttgaccct gggcgacggg atcaccgggc tggcaggggc ggcgctgacc       360
     atgctggcgg ggccaaagga ggcggataag cgtaaatatg atacggacgg gcgcaccttg       420
     ccagaagagc tctggtacgc cctgacgcac cccaagtcgc cgatactaat ggccgtcatg       480
     ctcgtcgtct gcggggctgc cggcctggcc ctctatccgt cgctctcctt cgagatgatc       540
     gcggccggcg cctttggcgc catggcggcg gacgcgttcc cctggcgcat cttcggcctg       600
     acggtggacg acaacctctc gatacccctg gtctccgggt gcctgatgtc gctggccgct       660
     atcgtgtaa                                                               669
//

If you have problems or comments...

PBIL Back to PBIL home page