(data stored in ACNUC10043 zone)

EMBL: AP011532.PE149

AP011532.PE149       Location/Qualifiers
FT   CDS_pept        complement(146788..147213)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0149"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0149"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60221"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUU9"
FT                   /protein_id="BAI60221.1"
FT                   /translation="MAKISPSEELVVNIRELCGDTIANDYVNMMNQVSQPRFSAIKNTF
FT                   KDSTSVFIMACANSNILYKDLREAGLKLGIASVETFSRRIYEMRRAGLIYTESMHNKGP
FT                   GRPKLRLRFNPNAFKEMFNMDPGTLLTAHPEEHKVVI"
     atggcaaaaa tatctccctc agaggagctt gtggtaaata tcagggagtt atgtggcgac        60
     accatcgcca acgattacgt caacatgatg aaccaggtca gccagcccag gttcagcgct       120
     attaaaaaca ccttcaagga ctcgacatct gtctttataa tggcttgcgc caacagcaat       180
     attctttata aggacttgag ggaagcgggc ttgaagctcg ggatagctag cgtggagacg       240
     ttctccaggc ggatatatga gatgcgccgg gcagggctca tctacacgga gtcgatgcat       300
     aacaaggggc ctggtaggcc aaagctaagg ctaagattca atccgaacgc attcaaggaa       360
     atgttcaaca tggacccggg cacgctgctt acggcccatc cggaagaaca caaagtagta       420
     atttaa                                                                  426
//

If you have problems or comments...

PBIL Back to PBIL home page