(data stored in ACNUC10043 zone)

EMBL: AP011532.PE152

AP011532.PE152       Location/Qualifiers
FT   CDS_pept        149066..149893
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0152"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one Cna B-type domain (IPR008454)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0152"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60224"
FT                   /db_xref="GOA:D1YUV2"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR026371"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV2"
FT                   /protein_id="BAI60224.1"
FT                   /translation="MKRIGLIVLAMVAIAFFVPAGMAQSTQVVNINGYVYSGALPMGGA
FT                   KVQLYSWDGKNMGNSPMKTVTTKDGSTGTGSFSFTNVPYDSSKTFNYVVKAELNDRTAY
FT                   ALVHIVPAQKAGEAAKAEAIVLDLAMDSWVTDLTGTVQSGNLLDRAIGVQGANVTIYER
FT                   NQTDGTVLPGVKATAVTDMNGKIEIKNLPYGLYQAVVTASVSGKNYQEKVDFTAYQQET
FT                   HINAIMSQLMLATPTPTPTPKPSGSGGLFGIPGFEAVLALVALSGTALFLRKR"
     gtgaagagga tcggattaat cgtactggct atggtggcga tagccttctt cgtgcctgcc        60
     ggcatggcgc agagcacgca agttgtgaac atcaacggat acgtatacag cggcgccctg       120
     cccatgggcg gcgcgaaagt gcagctatac tcctgggacg gcaagaacat ggggaactcg       180
     cccatgaaga ccgtcaccac gaaggacggg agcaccggca ccgggtcgtt ctccttcacg       240
     aacgtgccct acgactcatc caagaccttt aactacgtag tgaaggccga gcttaacgac       300
     aggacggcat atgcgctcgt ccacatcgtg cccgcccaga aggccggcga ggccgccaag       360
     gccgaagcca tcgtgcttga cctggccatg gactcgtggg tcaccgacct caccggcacg       420
     gtgcagagcg gcaatctact ggaccgcgcc ataggcgtcc agggcgccaa cgtgacgatc       480
     tatgagcgca accagaccga cggcacagtg ctgccagggg tcaaggcgac cgcggtcacc       540
     gacatgaacg gcaagatcga gatcaagaac ctgccctacg gcctctacca ggcggtcgtg       600
     acggcctccg tcagcggcaa gaactaccag gagaaagtgg acttcaccgc ctaccagcag       660
     gagacccaca ttaacgctat catgtcccag ctaatgctcg cgaccccgac ccccaccccg       720
     acgcccaagc ccagtggcag cggcgggctg ttcggcatcc cgggatttga ggcagtgctc       780
     gcgctcgtcg ccctctccgg cacggcactc ttcctcagga agcgttaa                    828
//

If you have problems or comments...

PBIL Back to PBIL home page