(data stored in ACNUC10043 zone)

EMBL: AP011532.PE159

AP011532.PE159       Location/Qualifiers
FT   CDS_pept        complement(154873..155199)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0159"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0159"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60231"
FT                   /db_xref="InterPro:IPR025874"
FT                   /db_xref="InterPro:IPR029038"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUV9"
FT                   /protein_id="BAI60231.1"
FT                   /translation="MAGYKQPCRYCGKLVPPDARICPYCGKGTPIGSLKCPRCRDNIEK
FT                   DYAVCPHCGLSLQTACPVCGKQTFFGDNCEVCGASLKVTCPKCGTVQPAVGPNCSKCGK
FT                   PLKK"
     atggccggtt ataagcagcc ctgccggtac tgcggcaagc tggtgccacc cgacgccagg        60
     atatgcccgt actgcggcaa gggaacgccc atcgggtcgc taaagtgccc ccggtgcagg       120
     gacaatatcg agaaggacta tgcggtatgc ccgcactgcg ggctgtcgct ccagacggcg       180
     tgccccgtgt gcggcaagca gaccttcttc ggggataact gcgaagtgtg cggcgcctcg       240
     ctcaaggtga cctgccccaa gtgcggcacg gtgcagcccg cggtgggccc gaattgctcg       300
     aaatgcggta agccattgaa aaagtaa                                           327
//

If you have problems or comments...

PBIL Back to PBIL home page