(data stored in ACNUC10043 zone)

EMBL: AP011532.PE164

AP011532.PE164       Location/Qualifiers
FT   CDS_pept        159524..160672
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0164"
FT                   /product="conserved hypothetical protein"
FT                   /note="Belongs to the Protein of unknown function DUF362
FT                   family (IPR007160).; Contains at least one 4Fe-4S
FT                   ferredoxin, iron-sulfur binding domain (IPR001450)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0164"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60236"
FT                   /db_xref="InterPro:IPR007160"
FT                   /db_xref="InterPro:IPR017896"
FT                   /db_xref="InterPro:IPR017900"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW4"
FT                   /protein_id="BAI60236.1"
FT                   /translation="MTFVSLVKNSDPSKAVSDAVQLAGGLEVSGTVLIKPNLSCAKPSG
FT                   SGLVTNVDVVVALVKMVAEQGAKPLVGDLPILGWDPKTVFDASGIRAIEQAGGELVDWS
FT                   AGHIEISLPGAKTLKRVPIARPALEVDAIINVPVLKHHFLTHLSGGMKNLFGLVQPEFR
FT                   PKVHVLGLDGPLVDFYEFLKPRIVLNVMDATSIAQSVRPAGPYYGPSEAKSAYQANMIL
FT                   ASKDAVALDAVAARVIGIEPDDVEMVRIAASRRLGDVNPRTVGNARGASVKIKSSLLGK
FT                   VMPYMEDAWTSQRLNRIAHPLAKRIYGQDIVSLKEVRREMNAIDPSRIVLAGNCTQCGL
FT                   CVNACPTKNIALGSKPAFGSKCIKCFICVEICPGGVLAIQRK"
     gtgacattcg tatccctcgt taagaacagc gatccttcaa aggccgtgag cgacgcggtc        60
     cagctcgccg gggggctcga ggtcagcggc accgtcctca tcaagcctaa cctgagctgt       120
     gcgaagcctt cgggcagcgg cctggtcacg aacgtcgacg ttgtcgtagc cctggtaaag       180
     atggtcgcgg agcagggggc gaaaccgcta gtcggggacc tgcctattct cgggtgggac       240
     ccgaagacgg tgttcgacgc gtccggcata cgcgccatcg agcaggcggg cggagagctc       300
     gtcgactgga gcgccggcca catcgagata tcgctgccgg gggcaaagac cctgaagaga       360
     gtgcccatcg cgaggccggc actcgaggtg gacgccatca tcaacgtacc cgtccttaag       420
     catcactttc tcactcatct ttccggaggc atgaagaacc ttttcgggct cgtgcagccc       480
     gagttcaggc cgaaggtcca cgtcctgggc ctggacgggc cattggtgga tttttacgag       540
     ttcctcaagc cccgcatcgt tttaaatgta atggacgcca cgagcatcgc ccagtcggtg       600
     aggcccgccg gcccgtacta cgggccctcc gaggctaaat cggcgtacca ggccaacatg       660
     atcctggcca gcaaggacgc ggtggcgctg gacgcggtgg cggcccgggt catcgggatc       720
     gagccggatg acgtggagat ggtgcgcatc gccgcatccc gacgcctggg cgacgtcaac       780
     ccgaggaccg tcgggaacgc ccggggcgcc agcgtgaaga tcaaaagctc gctcctcggc       840
     aaggtcatgc cgtacatgga ggacgcctgg acgagccagc gcctcaaccg gatagcccat       900
     ccgctcgcga agcgcatcta cggccaggac atcgtatcgc taaaggaggt ccgccgggag       960
     atgaacgcca tcgacccgtc ccgcatcgtg ctggctggaa attgtacgca gtgcggcctc      1020
     tgcgtgaacg cctgcccaac gaagaacatc gcgctcggca gcaagccggc cttcggctcg      1080
     aagtgcatca agtgcttcat ctgcgtcgag atatgcccgg gcggcgtgct ggccatccag      1140
     aggaagtga                                                              1149
//

If you have problems or comments...

PBIL Back to PBIL home page