(data stored in ACNUC10043 zone)

EMBL: AP011532.PE165

AP011532.PE165       Location/Qualifiers
FT   CDS_pept        160677..161417
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0165"
FT                   /product="phosphatidate cytidylyltransferase family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0165"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60237"
FT                   /db_xref="GOA:D1YUW5"
FT                   /db_xref="InterPro:IPR039606"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW5"
FT                   /protein_id="BAI60237.1"
FT                   /translation="MLGFSLHDVLGGVLVYVYIILIFLAVEKLWKGDRAVGRKILHIAM
FT                   GNIVFILAFFDNWYAEVLIAGSALLFSLLITQRMQLYFLNKLTVVPGEESFFRKAYRKV
FT                   IRKLSLISASDAGNEWGLVYYCLMFTVLAGLFAKSPVVVAVGMLPLAYGDGLGAVIGRK
FT                   FGRHPYRIIDKKSIEGSLAVFAGTALSLVGGMVYYGVPLQDAAWMSAAIGLVIMVVEGV
FT                   TPKGLDNLAIPLSAVVLFLLFGAV"
     ttgctcgggt tctccctgca tgacgtgctg ggcggggtcc tggtctatgt ctatatcatc        60
     ctgatctttt tagccgttga gaagctgtgg aagggcgaca gggccgtggg caggaagatc       120
     ctgcacatcg cgatgggcaa catcgtgttc attttagcct ttttcgataa ttggtacgcg       180
     gaggtgctca tcgcgggctc tgccctgctg ttctcgctgc tcattacgca gaggatgcag       240
     ctttacttct tgaacaagct taccgtggtg cctggcgagg agagcttttt ccgtaaggcg       300
     taccggaagg tcatccggaa gctgtcgctc atatcggcgt cggacgccgg gaacgagtgg       360
     gggctggttt attactgttt gatgttcacg gtgctcgccg ggcttttcgc gaagagcccc       420
     gtggtcgtgg ccgtcggcat gctccccctg gcttacgggg acggccttgg ggccgtcatc       480
     ggccggaagt tcggccgcca cccctaccgg atcatcgata agaagagcat cgagggctcc       540
     cttgccgtgt tcgccggcac cgccctctcc ctggtcgggg ggatggtata ttacggcgtg       600
     ccgctgcagg acgccgcctg gatgtccgcc gccataggcc tggtgatcat ggtcgtggag       660
     ggcgtgacgc ccaaagggct ggataacctg gccataccgc tgtccgcggt cgtcctattc       720
     ctattgttcg gggcggtctg a                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page