(data stored in ACNUC10043 zone)

EMBL: AP011532.PE166

AP011532.PE166       Location/Qualifiers
FT   CDS_pept        161417..161977
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0166"
FT                   /product="putative thymidylate kinase"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0166"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60238"
FT                   /db_xref="GOA:D1YUW6"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR039430"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUW6"
FT                   /protein_id="BAI60238.1"
FT                   /translation="MRFYVIDGLDGSGKDTQAYKLKEYLSKSGREVALRIHPASDNAFG
FT                   HIAKRSLVKSGAFWRLVATFFYGLDVVRSIILYCRGDRDVIFVRYTLACAYLPRAIIRP
FT                   VYAVVNFLLPKSPHMFFLDVSPEEALRRIKKRGDSEEMFETLPHLQKNRSRALLILGNW
FT                   KVVDGNVAPDKVFEQIVGSLSDQ"
     atgcgtttct acgttattga cggcctggac ggctcgggca aggataccca ggcgtataag        60
     ctgaaggagt acctctctaa gagcggccgg gaggtcgcgc tgcggattca tcctgcgagc       120
     gataacgcct tcgggcacat cgccaagcgc tcgctggtca agagcggcgc gttctggcgc       180
     ctcgtcgcga cgttctttta cggcctggac gtggtgcgct ccatcattct atattgccga       240
     ggggaccggg acgtcatctt cgtccggtac acgctcgcct gcgcctacct gcccagggcc       300
     atcatcaggc cagtctacgc cgtcgtaaac ttcctgctcc cgaagtcccc tcacatgttc       360
     ttcctggacg tctcgcccga ggaggcgctc cgccgcatca agaagcgggg ggacagcgag       420
     gagatgttcg agacgctgcc tcacctgcag aagaaccgtt cccgcgcttt gctcatcctc       480
     gggaactgga aggtcgttga cgggaacgtg gcgcccgata aggtatttga gcaaattgtg       540
     ggttccttat ccgatcaata a                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page