(data stored in ACNUC10043 zone)

EMBL: AP011532.PE174

AP011532.PE174       Location/Qualifiers
FT   CDS_pept        complement(168330..168890)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0174"
FT                   /product="conserved hypothetical protein"
FT                   /note="Contains one ThiJ/PfpI domain (IPR002818)."
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0174"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60246"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUX4"
FT                   /protein_id="BAI60246.1"
FT                   /translation="MEFSLDNTEIVLVAAPEGFRDEELFVPEDVFSGVGAFVLTASTTK
FT                   KPIYGSQGGSTLPDLHIEDIKVDSLNALVIAGGKGAREHLWHNEALLRKVREANEKGKV
FT                   IGAICISGAIPAIAGIMRGRRGTVYPDTGALEVLKENGETYVNEGVVVDGNVVTGAGPT
FT                   YAKEFAETILALLKERLPAAAQM"
     atggagttca gccttgataa cacggagatc gtgctggtcg cggccccgga ggggttcagg        60
     gacgaggagc tgttcgtgcc cgaggacgtt ttttcggggg tgggcgcctt cgtgctcacg       120
     gccagcacga ctaagaagcc gatatacggc tcgcagggcg gttcgacgct ccccgacctg       180
     cacatcgagg acatcaaagt cgacagcctg aacgccctgg tcatcgccgg cgggaagggc       240
     gcccgggagc acctgtggca caatgaggcg ctgcttcgaa aggtcaggga ggcgaacgag       300
     aagggcaagg tcatcggagc tatctgtata tcgggcgcaa tacccgctat cgcgggcatc       360
     atgcggggcc gcaggggcac cgtatacccc gataccgggg cgctggaagt gctgaaagag       420
     aacggcgaga cctacgtgaa cgagggcgtc gtcgtagacg ggaacgtggt cacgggggcg       480
     gggcccacgt acgctaagga gttcgccgag acaatattag cgctgctaaa ggaaaggctg       540
     cccgctgccg ctcagatgta g                                                 561
//

If you have problems or comments...

PBIL Back to PBIL home page