(data stored in ACNUC10043 zone)

EMBL: AP011532.PE18

AP011532.PE18        Location/Qualifiers
FT   CDS_pept        complement(12627..13274)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="MCP_0018"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:MCP_0018"
FT                   /db_xref="EnsemblGenomes-Tr:BAI60090"
FT                   /db_xref="InterPro:IPR025839"
FT                   /db_xref="UniProtKB/TrEMBL:D1YUG8"
FT                   /protein_id="BAI60090.1"
FT                   /translation="MTIVVSEDDEDADYSPFAFLETTVKNDILNVSHDYRYQKMGYYVS
FT                   MHAELCGCNVTPRCSDILDTHRNPLLMIRASRAGIPCLPYRLVAGDERNMGCPALCFAV
FT                   NPYTCNSVTQVKTESQLYRTLKSLSVNNRYPVSVQPLVGEVKEAVQVFGETDVPEARSI
FT                   AKKFYETFRIPIGKLIVQMVDGEAKLCHFEPTTKKEVDWALVRDKVHAVKCH"
     gtgacaattg ttgttagtga agacgacgaa gatgcggatt atagtccgtt tgccttttta        60
     gaaacgactg tcaagaacga tattttgaac gtatcgcacg attaccggta ccagaaaatg       120
     gggtattacg tatcgatgca cgcggaactt tgcggatgca acgtgacccc ccgctgttcg       180
     gacatccttg acacgcacag aaatcctctg ctgatgatca gggcgtccag ggcgggcatc       240
     ccgtgcctgc cgtacaggct ggtcgccggg gacgagcgca acatgggctg cccggcgtta       300
     tgcttcgcgg tgaacccgta cacgtgcaac tcggttaccc aggtcaagac ggagtcccaa       360
     ttataccgga ctctgaagag cctgagcgtt aacaaccgct acccggtctc ggttcagccc       420
     ctggtcgggg aggtaaagga ggccgtgcag gtcttcgggg agacggacgt gcccgaggcg       480
     cgctccatcg cgaagaagtt ctacgagacc ttcaggatac ccatcggcaa gctgatcgtg       540
     cagatggtgg atggcgaggc aaagctgtgc cacttcgagc ccacgacgaa gaaagaggtg       600
     gactgggccc tggtcaggga taaggtgcac gccgtaaagt gccactaa                    648
//

If you have problems or comments...

PBIL Back to PBIL home page